Cargando…

COVID-19 in 7780 pediatric patients: A systematic review

BACKGROUND: Studies summarizing the clinical picture of COVID-19 in children are lacking. This review characterizes clinical symptoms, laboratory, and imaging findings, as well as therapies provided to confirmed pediatric cases of COVID-19. METHODS: Adhering to PRISMA guidelines, we searched four me...

Descripción completa

Detalles Bibliográficos
Autores principales: Hoang, Ansel, Chorath, Kevin, Moreira, Axel, Evans, Mary, Burmeister-Morton, Finn, Burmeister, Fiona, Naqvi, Rija, Petershack, Matthew, Moreira, Alvaro
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Elsevier 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7318942/
https://www.ncbi.nlm.nih.gov/pubmed/32766542
http://dx.doi.org/10.1016/j.eclinm.2020.100433
_version_ 1783550960916758528
author Hoang, Ansel
Chorath, Kevin
Moreira, Axel
Evans, Mary
Burmeister-Morton, Finn
Burmeister, Fiona
Naqvi, Rija
Petershack, Matthew
Moreira, Alvaro
author_facet Hoang, Ansel
Chorath, Kevin
Moreira, Axel
Evans, Mary
Burmeister-Morton, Finn
Burmeister, Fiona
Naqvi, Rija
Petershack, Matthew
Moreira, Alvaro
author_sort Hoang, Ansel
collection PubMed
description BACKGROUND: Studies summarizing the clinical picture of COVID-19 in children are lacking. This review characterizes clinical symptoms, laboratory, and imaging findings, as well as therapies provided to confirmed pediatric cases of COVID-19. METHODS: Adhering to PRISMA guidelines, we searched four medical databases (PubMed, LitCovid, Scopus, WHO COVID-19 database) between December 1, 2019 to May 14, 2020 using the keywords “novel coronavirus”, “COVID-19” or “SARS-CoV-2”. We included published or in press peer-reviewed cross-sectional, case series, and case reports providing clinical signs, imaging findings, and/or laboratory results of pediatric patients who were positive for COVID-19. Risk of bias was appraised through the quality assessment tool published by the National Institutes of Health. PROSPERO registration # CRD42020182261. FINDINGS: We identified 131 studies across 26 countries comprising 7780 pediatric patients. Although fever (59·1%) and cough (55·9%) were the most frequent symptoms 19·3% of children were asymptomatic. Patchy lesions (21·0%) and ground-glass opacities (32·9%) depicted lung radiograph and computed tomography findings, respectively. Immunocompromised children or those with respiratory/cardiac disease comprised the largest subset of COVID-19 children with underlying medical conditions (152 of 233 individuals). Coinfections were observed in 5.6% of children and abnormal laboratory markers included serum D-dimer, procalcitonin, creatine kinase, and interleukin-6. Seven deaths were reported (0·09%) and 11 children (0·14%) met inclusion for multisystem inflammatory syndrome in children. INTERPRETATION: This review provides evidence that children diagnosed with COVID-19 have an overall excellent prognosis. Future longitudinal studies are needed to confirm our findings and better understand which patients are at increased risk for developing severe inflammation and multiorgan failure. FUNDING: Parker B. Francis and pilot grant from 2R25-HL126140. Funding agencies had no involvement in the study.
format Online
Article
Text
id pubmed-7318942
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Elsevier
record_format MEDLINE/PubMed
spelling pubmed-73189422020-06-29 COVID-19 in 7780 pediatric patients: A systematic review Hoang, Ansel Chorath, Kevin Moreira, Axel Evans, Mary Burmeister-Morton, Finn Burmeister, Fiona Naqvi, Rija Petershack, Matthew Moreira, Alvaro EClinicalMedicine Research paper BACKGROUND: Studies summarizing the clinical picture of COVID-19 in children are lacking. This review characterizes clinical symptoms, laboratory, and imaging findings, as well as therapies provided to confirmed pediatric cases of COVID-19. METHODS: Adhering to PRISMA guidelines, we searched four medical databases (PubMed, LitCovid, Scopus, WHO COVID-19 database) between December 1, 2019 to May 14, 2020 using the keywords “novel coronavirus”, “COVID-19” or “SARS-CoV-2”. We included published or in press peer-reviewed cross-sectional, case series, and case reports providing clinical signs, imaging findings, and/or laboratory results of pediatric patients who were positive for COVID-19. Risk of bias was appraised through the quality assessment tool published by the National Institutes of Health. PROSPERO registration # CRD42020182261. FINDINGS: We identified 131 studies across 26 countries comprising 7780 pediatric patients. Although fever (59·1%) and cough (55·9%) were the most frequent symptoms 19·3% of children were asymptomatic. Patchy lesions (21·0%) and ground-glass opacities (32·9%) depicted lung radiograph and computed tomography findings, respectively. Immunocompromised children or those with respiratory/cardiac disease comprised the largest subset of COVID-19 children with underlying medical conditions (152 of 233 individuals). Coinfections were observed in 5.6% of children and abnormal laboratory markers included serum D-dimer, procalcitonin, creatine kinase, and interleukin-6. Seven deaths were reported (0·09%) and 11 children (0·14%) met inclusion for multisystem inflammatory syndrome in children. INTERPRETATION: This review provides evidence that children diagnosed with COVID-19 have an overall excellent prognosis. Future longitudinal studies are needed to confirm our findings and better understand which patients are at increased risk for developing severe inflammation and multiorgan failure. FUNDING: Parker B. Francis and pilot grant from 2R25-HL126140. Funding agencies had no involvement in the study. Elsevier 2020-06-26 /pmc/articles/PMC7318942/ /pubmed/32766542 http://dx.doi.org/10.1016/j.eclinm.2020.100433 Text en © 2020 The Author(s) http://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/).
spellingShingle Research paper
Hoang, Ansel
Chorath, Kevin
Moreira, Axel
Evans, Mary
Burmeister-Morton, Finn
Burmeister, Fiona
Naqvi, Rija
Petershack, Matthew
Moreira, Alvaro
COVID-19 in 7780 pediatric patients: A systematic review
title COVID-19 in 7780 pediatric patients: A systematic review
title_full COVID-19 in 7780 pediatric patients: A systematic review
title_fullStr COVID-19 in 7780 pediatric patients: A systematic review
title_full_unstemmed COVID-19 in 7780 pediatric patients: A systematic review
title_short COVID-19 in 7780 pediatric patients: A systematic review
title_sort covid-19 in 7780 pediatric patients: a systematic review
topic Research paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7318942/
https://www.ncbi.nlm.nih.gov/pubmed/32766542
http://dx.doi.org/10.1016/j.eclinm.2020.100433
work_keys_str_mv AT hoangansel covid19in7780pediatricpatientsasystematicreview
AT chorathkevin covid19in7780pediatricpatientsasystematicreview
AT moreiraaxel covid19in7780pediatricpatientsasystematicreview
AT evansmary covid19in7780pediatricpatientsasystematicreview
AT burmeistermortonfinn covid19in7780pediatricpatientsasystematicreview
AT burmeisterfiona covid19in7780pediatricpatientsasystematicreview
AT naqvirija covid19in7780pediatricpatientsasystematicreview
AT petershackmatthew covid19in7780pediatricpatientsasystematicreview
AT moreiraalvaro covid19in7780pediatricpatientsasystematicreview