Cargando…

CCNY Accelerates Cylcin E Expression to Regulate the Proliferation of Laryngeal Carcinoma Cells via MEK/ERK Signaling Pathway

BACKGROUND: Laryngeal carcinoma is a common cancer among head and neck tumors, accounting for 0.5–1% new cancer cases or deaths of all tumors throughout the body. Despite improvements in diagnostic and therapy, the prognosis of laryngeal carcinoma patients still remains poor. Thus, it is very import...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhao, Xiaoting, Jiang, Mei, Wang, Ziyu, Chen, Xiaohong, Wang, Hongzhen, Yue, Wentao, Cai, Chao
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Dove 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7320751/
https://www.ncbi.nlm.nih.gov/pubmed/32606977
http://dx.doi.org/10.2147/CMAR.S241620
_version_ 1783551308059377664
author Zhao, Xiaoting
Jiang, Mei
Wang, Ziyu
Chen, Xiaohong
Wang, Hongzhen
Yue, Wentao
Cai, Chao
author_facet Zhao, Xiaoting
Jiang, Mei
Wang, Ziyu
Chen, Xiaohong
Wang, Hongzhen
Yue, Wentao
Cai, Chao
author_sort Zhao, Xiaoting
collection PubMed
description BACKGROUND: Laryngeal carcinoma is a common cancer among head and neck tumors, accounting for 0.5–1% new cancer cases or deaths of all tumors throughout the body. Despite improvements in diagnostic and therapy, the prognosis of laryngeal carcinoma patients still remains poor. Thus, it is very important to identify the biomarkers involved in the molecular pathogenesis of laryngeal carcinoma. Cyclin Y (CCNY) is a conserved cell cycle regulator that acts as a growth factor in many cancers. The clinical significance of CCNY in laryngeal carcinoma remains unknown. The function of CCNY in laryngocarcinoma was studied in this paper. MATERIALS AND METHODS: CCNY knock-out cells were constructed by CRISPR/CAS9 technique. CCNY overexpression cells were also constructed based on CCNY knock-out cells. Cell growth ability was detected by MTS assay, high-content cell analysis, colony formation assays, and anchorage-independent growth assays. The protein levels in laryngocarcinoma cells were determined by Western blot. The role of CCNY in cell cycle progression was evaluated by flow cytometry. RESULTS: CCNY knock-out cells and CCNY up-regulation cell models were obtained successfully. Suppression of CCNY expression inhibited Hep2 cell growth. Cell growth was enhanced by the up-regulation of CCNY. The percentage of cells in G1 phase was altered when CCNY expression was down-regulated or up-regulated. The phosphorylation level of MEK and ERK as well as cyclin E protein level was also regulated by the expression level of CCNY. CONCLUSION: In laryngocarcinoma cell line Hep2 cells, cell proliferation was controlled by CCNY. The expression of CCNY was involved in the cell cycle progress of Hep2 cells. It indicated that CCNY could promote cell growth by activating MEK/ERK/cyclin E signaling pathway.
format Online
Article
Text
id pubmed-7320751
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Dove
record_format MEDLINE/PubMed
spelling pubmed-73207512020-06-29 CCNY Accelerates Cylcin E Expression to Regulate the Proliferation of Laryngeal Carcinoma Cells via MEK/ERK Signaling Pathway Zhao, Xiaoting Jiang, Mei Wang, Ziyu Chen, Xiaohong Wang, Hongzhen Yue, Wentao Cai, Chao Cancer Manag Res Original Research BACKGROUND: Laryngeal carcinoma is a common cancer among head and neck tumors, accounting for 0.5–1% new cancer cases or deaths of all tumors throughout the body. Despite improvements in diagnostic and therapy, the prognosis of laryngeal carcinoma patients still remains poor. Thus, it is very important to identify the biomarkers involved in the molecular pathogenesis of laryngeal carcinoma. Cyclin Y (CCNY) is a conserved cell cycle regulator that acts as a growth factor in many cancers. The clinical significance of CCNY in laryngeal carcinoma remains unknown. The function of CCNY in laryngocarcinoma was studied in this paper. MATERIALS AND METHODS: CCNY knock-out cells were constructed by CRISPR/CAS9 technique. CCNY overexpression cells were also constructed based on CCNY knock-out cells. Cell growth ability was detected by MTS assay, high-content cell analysis, colony formation assays, and anchorage-independent growth assays. The protein levels in laryngocarcinoma cells were determined by Western blot. The role of CCNY in cell cycle progression was evaluated by flow cytometry. RESULTS: CCNY knock-out cells and CCNY up-regulation cell models were obtained successfully. Suppression of CCNY expression inhibited Hep2 cell growth. Cell growth was enhanced by the up-regulation of CCNY. The percentage of cells in G1 phase was altered when CCNY expression was down-regulated or up-regulated. The phosphorylation level of MEK and ERK as well as cyclin E protein level was also regulated by the expression level of CCNY. CONCLUSION: In laryngocarcinoma cell line Hep2 cells, cell proliferation was controlled by CCNY. The expression of CCNY was involved in the cell cycle progress of Hep2 cells. It indicated that CCNY could promote cell growth by activating MEK/ERK/cyclin E signaling pathway. Dove 2020-06-23 /pmc/articles/PMC7320751/ /pubmed/32606977 http://dx.doi.org/10.2147/CMAR.S241620 Text en © 2020 Zhao et al. http://creativecommons.org/licenses/by-nc/3.0/ This work is published and licensed by Dove Medical Press Limited. The full terms of this license are available at https://www.dovepress.com/terms.php and incorporate the Creative Commons Attribution – Non Commercial (unported, v3.0) License (http://creativecommons.org/licenses/by-nc/3.0/). By accessing the work you hereby accept the Terms. Non-commercial uses of the work are permitted without any further permission from Dove Medical Press Limited, provided the work is properly attributed. For permission for commercial use of this work, please see paragraphs 4.2 and 5 of our Terms (https://www.dovepress.com/terms.php).
spellingShingle Original Research
Zhao, Xiaoting
Jiang, Mei
Wang, Ziyu
Chen, Xiaohong
Wang, Hongzhen
Yue, Wentao
Cai, Chao
CCNY Accelerates Cylcin E Expression to Regulate the Proliferation of Laryngeal Carcinoma Cells via MEK/ERK Signaling Pathway
title CCNY Accelerates Cylcin E Expression to Regulate the Proliferation of Laryngeal Carcinoma Cells via MEK/ERK Signaling Pathway
title_full CCNY Accelerates Cylcin E Expression to Regulate the Proliferation of Laryngeal Carcinoma Cells via MEK/ERK Signaling Pathway
title_fullStr CCNY Accelerates Cylcin E Expression to Regulate the Proliferation of Laryngeal Carcinoma Cells via MEK/ERK Signaling Pathway
title_full_unstemmed CCNY Accelerates Cylcin E Expression to Regulate the Proliferation of Laryngeal Carcinoma Cells via MEK/ERK Signaling Pathway
title_short CCNY Accelerates Cylcin E Expression to Regulate the Proliferation of Laryngeal Carcinoma Cells via MEK/ERK Signaling Pathway
title_sort ccny accelerates cylcin e expression to regulate the proliferation of laryngeal carcinoma cells via mek/erk signaling pathway
topic Original Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7320751/
https://www.ncbi.nlm.nih.gov/pubmed/32606977
http://dx.doi.org/10.2147/CMAR.S241620
work_keys_str_mv AT zhaoxiaoting ccnyacceleratescylcineexpressiontoregulatetheproliferationoflaryngealcarcinomacellsviamekerksignalingpathway
AT jiangmei ccnyacceleratescylcineexpressiontoregulatetheproliferationoflaryngealcarcinomacellsviamekerksignalingpathway
AT wangziyu ccnyacceleratescylcineexpressiontoregulatetheproliferationoflaryngealcarcinomacellsviamekerksignalingpathway
AT chenxiaohong ccnyacceleratescylcineexpressiontoregulatetheproliferationoflaryngealcarcinomacellsviamekerksignalingpathway
AT wanghongzhen ccnyacceleratescylcineexpressiontoregulatetheproliferationoflaryngealcarcinomacellsviamekerksignalingpathway
AT yuewentao ccnyacceleratescylcineexpressiontoregulatetheproliferationoflaryngealcarcinomacellsviamekerksignalingpathway
AT caichao ccnyacceleratescylcineexpressiontoregulatetheproliferationoflaryngealcarcinomacellsviamekerksignalingpathway