Cargando…

Characteristics of New Peptides GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT as Inhibitors of Enzymes Involved in Metabolic Syndrome and Antimicrobial Potential

The aim of this study was to determine the cytotoxic properties, influence on enzyme activity involved in metabolic syndrome, and antimicrobial activity of synthetic peptides with GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT sequences. Peptides have no cyt...

Descripción completa

Detalles Bibliográficos
Autores principales: Złotek, Urszula, Jakubczyk, Anna, Rybczyńska-Tkaczyk, Kamila, Ćwiek, Paula, Baraniak, Barbara, Lewicki, Sławomir
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7321301/
https://www.ncbi.nlm.nih.gov/pubmed/32471271
http://dx.doi.org/10.3390/molecules25112492
_version_ 1783551432989868032
author Złotek, Urszula
Jakubczyk, Anna
Rybczyńska-Tkaczyk, Kamila
Ćwiek, Paula
Baraniak, Barbara
Lewicki, Sławomir
author_facet Złotek, Urszula
Jakubczyk, Anna
Rybczyńska-Tkaczyk, Kamila
Ćwiek, Paula
Baraniak, Barbara
Lewicki, Sławomir
author_sort Złotek, Urszula
collection PubMed
description The aim of this study was to determine the cytotoxic properties, influence on enzyme activity involved in metabolic syndrome, and antimicrobial activity of synthetic peptides with GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT sequences. Peptides have no cytotoxic effect on cells. The highest inhibitory effect on angiotensin converting enzyme I was noted for peptide GT-14 (IC(50) = 525.63 µg/mL). None of the tested peptides had an influence on α-glucosidase. The highest α-amylase and lipase inhibitory activity was noted for GG-12 (IC(50) = 56.72 and 60.62 µg/mL, respectively). The highest lipoxidase inhibitory activity was determined for peptide ER-13 (IC(50) = 84.35 µg/mL). Peptide RQ-9 was characterized by the highest COX inhibitory activity (0.31 and 4.77 µg/mL for COX-1 and COX-2, respectively). Only peptide RQ-9 inhibited S. enteritidis ATCC 4931 growth (42–48%) in all tested concentrations (15.62–250 mg/mL).
format Online
Article
Text
id pubmed-7321301
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-73213012020-06-29 Characteristics of New Peptides GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT as Inhibitors of Enzymes Involved in Metabolic Syndrome and Antimicrobial Potential Złotek, Urszula Jakubczyk, Anna Rybczyńska-Tkaczyk, Kamila Ćwiek, Paula Baraniak, Barbara Lewicki, Sławomir Molecules Article The aim of this study was to determine the cytotoxic properties, influence on enzyme activity involved in metabolic syndrome, and antimicrobial activity of synthetic peptides with GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT sequences. Peptides have no cytotoxic effect on cells. The highest inhibitory effect on angiotensin converting enzyme I was noted for peptide GT-14 (IC(50) = 525.63 µg/mL). None of the tested peptides had an influence on α-glucosidase. The highest α-amylase and lipase inhibitory activity was noted for GG-12 (IC(50) = 56.72 and 60.62 µg/mL, respectively). The highest lipoxidase inhibitory activity was determined for peptide ER-13 (IC(50) = 84.35 µg/mL). Peptide RQ-9 was characterized by the highest COX inhibitory activity (0.31 and 4.77 µg/mL for COX-1 and COX-2, respectively). Only peptide RQ-9 inhibited S. enteritidis ATCC 4931 growth (42–48%) in all tested concentrations (15.62–250 mg/mL). MDPI 2020-05-27 /pmc/articles/PMC7321301/ /pubmed/32471271 http://dx.doi.org/10.3390/molecules25112492 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Złotek, Urszula
Jakubczyk, Anna
Rybczyńska-Tkaczyk, Kamila
Ćwiek, Paula
Baraniak, Barbara
Lewicki, Sławomir
Characteristics of New Peptides GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT as Inhibitors of Enzymes Involved in Metabolic Syndrome and Antimicrobial Potential
title Characteristics of New Peptides GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT as Inhibitors of Enzymes Involved in Metabolic Syndrome and Antimicrobial Potential
title_full Characteristics of New Peptides GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT as Inhibitors of Enzymes Involved in Metabolic Syndrome and Antimicrobial Potential
title_fullStr Characteristics of New Peptides GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT as Inhibitors of Enzymes Involved in Metabolic Syndrome and Antimicrobial Potential
title_full_unstemmed Characteristics of New Peptides GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT as Inhibitors of Enzymes Involved in Metabolic Syndrome and Antimicrobial Potential
title_short Characteristics of New Peptides GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT as Inhibitors of Enzymes Involved in Metabolic Syndrome and Antimicrobial Potential
title_sort characteristics of new peptides gqlgehggagmg, gehggagmgggqfqpv, eqgflpgpeesgr, rlaraglaq, ygnpvggvgh, and gnpvggvghgttgt as inhibitors of enzymes involved in metabolic syndrome and antimicrobial potential
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7321301/
https://www.ncbi.nlm.nih.gov/pubmed/32471271
http://dx.doi.org/10.3390/molecules25112492
work_keys_str_mv AT złotekurszula characteristicsofnewpeptidesgqlgehggagmggehggagmgggqfqpveqgflpgpeesgrrlaraglaqygnpvggvghandgnpvggvghgttgtasinhibitorsofenzymesinvolvedinmetabolicsyndromeandantimicrobialpotential
AT jakubczykanna characteristicsofnewpeptidesgqlgehggagmggehggagmgggqfqpveqgflpgpeesgrrlaraglaqygnpvggvghandgnpvggvghgttgtasinhibitorsofenzymesinvolvedinmetabolicsyndromeandantimicrobialpotential
AT rybczynskatkaczykkamila characteristicsofnewpeptidesgqlgehggagmggehggagmgggqfqpveqgflpgpeesgrrlaraglaqygnpvggvghandgnpvggvghgttgtasinhibitorsofenzymesinvolvedinmetabolicsyndromeandantimicrobialpotential
AT cwiekpaula characteristicsofnewpeptidesgqlgehggagmggehggagmgggqfqpveqgflpgpeesgrrlaraglaqygnpvggvghandgnpvggvghgttgtasinhibitorsofenzymesinvolvedinmetabolicsyndromeandantimicrobialpotential
AT baraniakbarbara characteristicsofnewpeptidesgqlgehggagmggehggagmgggqfqpveqgflpgpeesgrrlaraglaqygnpvggvghandgnpvggvghgttgtasinhibitorsofenzymesinvolvedinmetabolicsyndromeandantimicrobialpotential
AT lewickisławomir characteristicsofnewpeptidesgqlgehggagmggehggagmgggqfqpveqgflpgpeesgrrlaraglaqygnpvggvghandgnpvggvghgttgtasinhibitorsofenzymesinvolvedinmetabolicsyndromeandantimicrobialpotential