Cargando…
Characteristics of New Peptides GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT as Inhibitors of Enzymes Involved in Metabolic Syndrome and Antimicrobial Potential
The aim of this study was to determine the cytotoxic properties, influence on enzyme activity involved in metabolic syndrome, and antimicrobial activity of synthetic peptides with GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT sequences. Peptides have no cyt...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7321301/ https://www.ncbi.nlm.nih.gov/pubmed/32471271 http://dx.doi.org/10.3390/molecules25112492 |
_version_ | 1783551432989868032 |
---|---|
author | Złotek, Urszula Jakubczyk, Anna Rybczyńska-Tkaczyk, Kamila Ćwiek, Paula Baraniak, Barbara Lewicki, Sławomir |
author_facet | Złotek, Urszula Jakubczyk, Anna Rybczyńska-Tkaczyk, Kamila Ćwiek, Paula Baraniak, Barbara Lewicki, Sławomir |
author_sort | Złotek, Urszula |
collection | PubMed |
description | The aim of this study was to determine the cytotoxic properties, influence on enzyme activity involved in metabolic syndrome, and antimicrobial activity of synthetic peptides with GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT sequences. Peptides have no cytotoxic effect on cells. The highest inhibitory effect on angiotensin converting enzyme I was noted for peptide GT-14 (IC(50) = 525.63 µg/mL). None of the tested peptides had an influence on α-glucosidase. The highest α-amylase and lipase inhibitory activity was noted for GG-12 (IC(50) = 56.72 and 60.62 µg/mL, respectively). The highest lipoxidase inhibitory activity was determined for peptide ER-13 (IC(50) = 84.35 µg/mL). Peptide RQ-9 was characterized by the highest COX inhibitory activity (0.31 and 4.77 µg/mL for COX-1 and COX-2, respectively). Only peptide RQ-9 inhibited S. enteritidis ATCC 4931 growth (42–48%) in all tested concentrations (15.62–250 mg/mL). |
format | Online Article Text |
id | pubmed-7321301 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-73213012020-06-29 Characteristics of New Peptides GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT as Inhibitors of Enzymes Involved in Metabolic Syndrome and Antimicrobial Potential Złotek, Urszula Jakubczyk, Anna Rybczyńska-Tkaczyk, Kamila Ćwiek, Paula Baraniak, Barbara Lewicki, Sławomir Molecules Article The aim of this study was to determine the cytotoxic properties, influence on enzyme activity involved in metabolic syndrome, and antimicrobial activity of synthetic peptides with GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT sequences. Peptides have no cytotoxic effect on cells. The highest inhibitory effect on angiotensin converting enzyme I was noted for peptide GT-14 (IC(50) = 525.63 µg/mL). None of the tested peptides had an influence on α-glucosidase. The highest α-amylase and lipase inhibitory activity was noted for GG-12 (IC(50) = 56.72 and 60.62 µg/mL, respectively). The highest lipoxidase inhibitory activity was determined for peptide ER-13 (IC(50) = 84.35 µg/mL). Peptide RQ-9 was characterized by the highest COX inhibitory activity (0.31 and 4.77 µg/mL for COX-1 and COX-2, respectively). Only peptide RQ-9 inhibited S. enteritidis ATCC 4931 growth (42–48%) in all tested concentrations (15.62–250 mg/mL). MDPI 2020-05-27 /pmc/articles/PMC7321301/ /pubmed/32471271 http://dx.doi.org/10.3390/molecules25112492 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Złotek, Urszula Jakubczyk, Anna Rybczyńska-Tkaczyk, Kamila Ćwiek, Paula Baraniak, Barbara Lewicki, Sławomir Characteristics of New Peptides GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT as Inhibitors of Enzymes Involved in Metabolic Syndrome and Antimicrobial Potential |
title | Characteristics of New Peptides GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT as Inhibitors of Enzymes Involved in Metabolic Syndrome and Antimicrobial Potential |
title_full | Characteristics of New Peptides GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT as Inhibitors of Enzymes Involved in Metabolic Syndrome and Antimicrobial Potential |
title_fullStr | Characteristics of New Peptides GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT as Inhibitors of Enzymes Involved in Metabolic Syndrome and Antimicrobial Potential |
title_full_unstemmed | Characteristics of New Peptides GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT as Inhibitors of Enzymes Involved in Metabolic Syndrome and Antimicrobial Potential |
title_short | Characteristics of New Peptides GQLGEHGGAGMG, GEHGGAGMGGGQFQPV, EQGFLPGPEESGR, RLARAGLAQ, YGNPVGGVGH, and GNPVGGVGHGTTGT as Inhibitors of Enzymes Involved in Metabolic Syndrome and Antimicrobial Potential |
title_sort | characteristics of new peptides gqlgehggagmg, gehggagmgggqfqpv, eqgflpgpeesgr, rlaraglaq, ygnpvggvgh, and gnpvggvghgttgt as inhibitors of enzymes involved in metabolic syndrome and antimicrobial potential |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7321301/ https://www.ncbi.nlm.nih.gov/pubmed/32471271 http://dx.doi.org/10.3390/molecules25112492 |
work_keys_str_mv | AT złotekurszula characteristicsofnewpeptidesgqlgehggagmggehggagmgggqfqpveqgflpgpeesgrrlaraglaqygnpvggvghandgnpvggvghgttgtasinhibitorsofenzymesinvolvedinmetabolicsyndromeandantimicrobialpotential AT jakubczykanna characteristicsofnewpeptidesgqlgehggagmggehggagmgggqfqpveqgflpgpeesgrrlaraglaqygnpvggvghandgnpvggvghgttgtasinhibitorsofenzymesinvolvedinmetabolicsyndromeandantimicrobialpotential AT rybczynskatkaczykkamila characteristicsofnewpeptidesgqlgehggagmggehggagmgggqfqpveqgflpgpeesgrrlaraglaqygnpvggvghandgnpvggvghgttgtasinhibitorsofenzymesinvolvedinmetabolicsyndromeandantimicrobialpotential AT cwiekpaula characteristicsofnewpeptidesgqlgehggagmggehggagmgggqfqpveqgflpgpeesgrrlaraglaqygnpvggvghandgnpvggvghgttgtasinhibitorsofenzymesinvolvedinmetabolicsyndromeandantimicrobialpotential AT baraniakbarbara characteristicsofnewpeptidesgqlgehggagmggehggagmgggqfqpveqgflpgpeesgrrlaraglaqygnpvggvghandgnpvggvghgttgtasinhibitorsofenzymesinvolvedinmetabolicsyndromeandantimicrobialpotential AT lewickisławomir characteristicsofnewpeptidesgqlgehggagmggehggagmgggqfqpveqgflpgpeesgrrlaraglaqygnpvggvghandgnpvggvghgttgtasinhibitorsofenzymesinvolvedinmetabolicsyndromeandantimicrobialpotential |