Cargando…
Nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within Cochrane systematic reviews
BACKGROUND: Nudge interventions are those that seek to modify the social and physical environment to enhance capacity for subconscious behaviours that align with the intrinsic values of an individual, without actively restricting options. This study sought to describe the application and effects of...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7329401/ https://www.ncbi.nlm.nih.gov/pubmed/32611354 http://dx.doi.org/10.1186/s13012-020-01011-0 |
_version_ | 1783552894674403328 |
---|---|
author | Yoong, Sze Lin Hall, Alix Stacey, Fiona Grady, Alice Sutherland, Rachel Wyse, Rebecca Anderson, Amy Nathan, Nicole Wolfenden, Luke |
author_facet | Yoong, Sze Lin Hall, Alix Stacey, Fiona Grady, Alice Sutherland, Rachel Wyse, Rebecca Anderson, Amy Nathan, Nicole Wolfenden, Luke |
author_sort | Yoong, Sze Lin |
collection | PubMed |
description | BACKGROUND: Nudge interventions are those that seek to modify the social and physical environment to enhance capacity for subconscious behaviours that align with the intrinsic values of an individual, without actively restricting options. This study sought to describe the application and effects of nudge strategies on clinician implementation of health-related guidelines, policies and practices within studies included in relevant Cochrane systematic reviews. METHODS: As there is varied terminology used to describe nudge, this study examined studies within relevant systematic reviews. A two-stage screening process was undertaken where, firstly, all systematic reviews published in the Cochrane Library between 2016 and 2018 were screened to identify reviews that included quantitative studies to improve implementation of guidelines among healthcare providers. Secondly, individual studies within relevant systematic reviews were included if they were (i) randomised controlled trials (RCTs), (ii) included a nudge strategy in at least one intervention arm, and (iii) explicitly aimed to improve clinician implementation behaviour. We categorised nudge strategies into priming, salience and affect, default, incentives, commitment and ego, and norms and messenger based on the Mindspace framework. SYNTHESIS: The number and percentage of trials using each nudge strategy was calculated. Due to substantial heterogeneity, we did not undertake a meta-analysis. Instead, we calculated within-study point estimates and 95% confidence intervals, and used a vote-counting approach to explore effects. RESULTS: Seven reviews including 42 trials reporting on 57 outcomes were included. The most common nudge strategy was priming (69%), then norms and messenger (40%). Of the 57 outcomes, 86% had an effect on clinician behaviour in the hypothesised direction, and 53% of those were statistically significant. For continuous outcomes, the median effect size was 0.39 (0.22, 0.45), while for dichotomous outcomes the median Odds Ratio was 1.62 (1.13, 2.76). CONCLUSIONS: This review of 42 RCTs included in Cochrane systematic reviews found that the impact of nudge strategies on clinician behaviour was at least comparable to other interventions targeting implementation of evidence-based guidelines. While uncertainty remains, the review provides justification for ongoing investigation of the evaluation and application of nudge interventions to support provider behaviour change. TRIAL REGISTRATION: This review was not prospectively registered. |
format | Online Article Text |
id | pubmed-7329401 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-73294012020-07-02 Nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within Cochrane systematic reviews Yoong, Sze Lin Hall, Alix Stacey, Fiona Grady, Alice Sutherland, Rachel Wyse, Rebecca Anderson, Amy Nathan, Nicole Wolfenden, Luke Implement Sci Systematic Review BACKGROUND: Nudge interventions are those that seek to modify the social and physical environment to enhance capacity for subconscious behaviours that align with the intrinsic values of an individual, without actively restricting options. This study sought to describe the application and effects of nudge strategies on clinician implementation of health-related guidelines, policies and practices within studies included in relevant Cochrane systematic reviews. METHODS: As there is varied terminology used to describe nudge, this study examined studies within relevant systematic reviews. A two-stage screening process was undertaken where, firstly, all systematic reviews published in the Cochrane Library between 2016 and 2018 were screened to identify reviews that included quantitative studies to improve implementation of guidelines among healthcare providers. Secondly, individual studies within relevant systematic reviews were included if they were (i) randomised controlled trials (RCTs), (ii) included a nudge strategy in at least one intervention arm, and (iii) explicitly aimed to improve clinician implementation behaviour. We categorised nudge strategies into priming, salience and affect, default, incentives, commitment and ego, and norms and messenger based on the Mindspace framework. SYNTHESIS: The number and percentage of trials using each nudge strategy was calculated. Due to substantial heterogeneity, we did not undertake a meta-analysis. Instead, we calculated within-study point estimates and 95% confidence intervals, and used a vote-counting approach to explore effects. RESULTS: Seven reviews including 42 trials reporting on 57 outcomes were included. The most common nudge strategy was priming (69%), then norms and messenger (40%). Of the 57 outcomes, 86% had an effect on clinician behaviour in the hypothesised direction, and 53% of those were statistically significant. For continuous outcomes, the median effect size was 0.39 (0.22, 0.45), while for dichotomous outcomes the median Odds Ratio was 1.62 (1.13, 2.76). CONCLUSIONS: This review of 42 RCTs included in Cochrane systematic reviews found that the impact of nudge strategies on clinician behaviour was at least comparable to other interventions targeting implementation of evidence-based guidelines. While uncertainty remains, the review provides justification for ongoing investigation of the evaluation and application of nudge interventions to support provider behaviour change. TRIAL REGISTRATION: This review was not prospectively registered. BioMed Central 2020-07-01 /pmc/articles/PMC7329401/ /pubmed/32611354 http://dx.doi.org/10.1186/s13012-020-01011-0 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Systematic Review Yoong, Sze Lin Hall, Alix Stacey, Fiona Grady, Alice Sutherland, Rachel Wyse, Rebecca Anderson, Amy Nathan, Nicole Wolfenden, Luke Nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within Cochrane systematic reviews |
title | Nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within Cochrane systematic reviews |
title_full | Nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within Cochrane systematic reviews |
title_fullStr | Nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within Cochrane systematic reviews |
title_full_unstemmed | Nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within Cochrane systematic reviews |
title_short | Nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within Cochrane systematic reviews |
title_sort | nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within cochrane systematic reviews |
topic | Systematic Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7329401/ https://www.ncbi.nlm.nih.gov/pubmed/32611354 http://dx.doi.org/10.1186/s13012-020-01011-0 |
work_keys_str_mv | AT yoongszelin nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews AT hallalix nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews AT staceyfiona nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews AT gradyalice nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews AT sutherlandrachel nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews AT wyserebecca nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews AT andersonamy nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews AT nathannicole nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews AT wolfendenluke nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews |