Cargando…

Nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within Cochrane systematic reviews

BACKGROUND: Nudge interventions are those that seek to modify the social and physical environment to enhance capacity for subconscious behaviours that align with the intrinsic values of an individual, without actively restricting options. This study sought to describe the application and effects of...

Descripción completa

Detalles Bibliográficos
Autores principales: Yoong, Sze Lin, Hall, Alix, Stacey, Fiona, Grady, Alice, Sutherland, Rachel, Wyse, Rebecca, Anderson, Amy, Nathan, Nicole, Wolfenden, Luke
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7329401/
https://www.ncbi.nlm.nih.gov/pubmed/32611354
http://dx.doi.org/10.1186/s13012-020-01011-0
_version_ 1783552894674403328
author Yoong, Sze Lin
Hall, Alix
Stacey, Fiona
Grady, Alice
Sutherland, Rachel
Wyse, Rebecca
Anderson, Amy
Nathan, Nicole
Wolfenden, Luke
author_facet Yoong, Sze Lin
Hall, Alix
Stacey, Fiona
Grady, Alice
Sutherland, Rachel
Wyse, Rebecca
Anderson, Amy
Nathan, Nicole
Wolfenden, Luke
author_sort Yoong, Sze Lin
collection PubMed
description BACKGROUND: Nudge interventions are those that seek to modify the social and physical environment to enhance capacity for subconscious behaviours that align with the intrinsic values of an individual, without actively restricting options. This study sought to describe the application and effects of nudge strategies on clinician implementation of health-related guidelines, policies and practices within studies included in relevant Cochrane systematic reviews. METHODS: As there is varied terminology used to describe nudge, this study examined studies within relevant systematic reviews. A two-stage screening process was undertaken where, firstly, all systematic reviews published in the Cochrane Library between 2016 and 2018 were screened to identify reviews that included quantitative studies to improve implementation of guidelines among healthcare providers. Secondly, individual studies within relevant systematic reviews were included if they were (i) randomised controlled trials (RCTs), (ii) included a nudge strategy in at least one intervention arm, and (iii) explicitly aimed to improve clinician implementation behaviour. We categorised nudge strategies into priming, salience and affect, default, incentives, commitment and ego, and norms and messenger based on the Mindspace framework. SYNTHESIS: The number and percentage of trials using each nudge strategy was calculated. Due to substantial heterogeneity, we did not undertake a meta-analysis. Instead, we calculated within-study point estimates and 95% confidence intervals, and used a vote-counting approach to explore effects. RESULTS: Seven reviews including 42 trials reporting on 57 outcomes were included. The most common nudge strategy was priming (69%), then norms and messenger (40%). Of the 57 outcomes, 86% had an effect on clinician behaviour in the hypothesised direction, and 53% of those were statistically significant. For continuous outcomes, the median effect size was 0.39 (0.22, 0.45), while for dichotomous outcomes the median Odds Ratio was 1.62 (1.13, 2.76). CONCLUSIONS: This review of 42 RCTs included in Cochrane systematic reviews found that the impact of nudge strategies on clinician behaviour was at least comparable to other interventions targeting implementation of evidence-based guidelines. While uncertainty remains, the review provides justification for ongoing investigation of the evaluation and application of nudge interventions to support provider behaviour change. TRIAL REGISTRATION: This review was not prospectively registered.
format Online
Article
Text
id pubmed-7329401
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-73294012020-07-02 Nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within Cochrane systematic reviews Yoong, Sze Lin Hall, Alix Stacey, Fiona Grady, Alice Sutherland, Rachel Wyse, Rebecca Anderson, Amy Nathan, Nicole Wolfenden, Luke Implement Sci Systematic Review BACKGROUND: Nudge interventions are those that seek to modify the social and physical environment to enhance capacity for subconscious behaviours that align with the intrinsic values of an individual, without actively restricting options. This study sought to describe the application and effects of nudge strategies on clinician implementation of health-related guidelines, policies and practices within studies included in relevant Cochrane systematic reviews. METHODS: As there is varied terminology used to describe nudge, this study examined studies within relevant systematic reviews. A two-stage screening process was undertaken where, firstly, all systematic reviews published in the Cochrane Library between 2016 and 2018 were screened to identify reviews that included quantitative studies to improve implementation of guidelines among healthcare providers. Secondly, individual studies within relevant systematic reviews were included if they were (i) randomised controlled trials (RCTs), (ii) included a nudge strategy in at least one intervention arm, and (iii) explicitly aimed to improve clinician implementation behaviour. We categorised nudge strategies into priming, salience and affect, default, incentives, commitment and ego, and norms and messenger based on the Mindspace framework. SYNTHESIS: The number and percentage of trials using each nudge strategy was calculated. Due to substantial heterogeneity, we did not undertake a meta-analysis. Instead, we calculated within-study point estimates and 95% confidence intervals, and used a vote-counting approach to explore effects. RESULTS: Seven reviews including 42 trials reporting on 57 outcomes were included. The most common nudge strategy was priming (69%), then norms and messenger (40%). Of the 57 outcomes, 86% had an effect on clinician behaviour in the hypothesised direction, and 53% of those were statistically significant. For continuous outcomes, the median effect size was 0.39 (0.22, 0.45), while for dichotomous outcomes the median Odds Ratio was 1.62 (1.13, 2.76). CONCLUSIONS: This review of 42 RCTs included in Cochrane systematic reviews found that the impact of nudge strategies on clinician behaviour was at least comparable to other interventions targeting implementation of evidence-based guidelines. While uncertainty remains, the review provides justification for ongoing investigation of the evaluation and application of nudge interventions to support provider behaviour change. TRIAL REGISTRATION: This review was not prospectively registered. BioMed Central 2020-07-01 /pmc/articles/PMC7329401/ /pubmed/32611354 http://dx.doi.org/10.1186/s13012-020-01011-0 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Systematic Review
Yoong, Sze Lin
Hall, Alix
Stacey, Fiona
Grady, Alice
Sutherland, Rachel
Wyse, Rebecca
Anderson, Amy
Nathan, Nicole
Wolfenden, Luke
Nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within Cochrane systematic reviews
title Nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within Cochrane systematic reviews
title_full Nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within Cochrane systematic reviews
title_fullStr Nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within Cochrane systematic reviews
title_full_unstemmed Nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within Cochrane systematic reviews
title_short Nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within Cochrane systematic reviews
title_sort nudge strategies to improve healthcare providers’ implementation of evidence-based guidelines, policies and practices: a systematic review of trials included within cochrane systematic reviews
topic Systematic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7329401/
https://www.ncbi.nlm.nih.gov/pubmed/32611354
http://dx.doi.org/10.1186/s13012-020-01011-0
work_keys_str_mv AT yoongszelin nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews
AT hallalix nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews
AT staceyfiona nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews
AT gradyalice nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews
AT sutherlandrachel nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews
AT wyserebecca nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews
AT andersonamy nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews
AT nathannicole nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews
AT wolfendenluke nudgestrategiestoimprovehealthcareprovidersimplementationofevidencebasedguidelinespoliciesandpracticesasystematicreviewoftrialsincludedwithincochranesystematicreviews