Cargando…
Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains
Vietnam is one of the countries most affected worldwide by the highly pathogenic avian influenza (HPAI) virus, which caused enormous economic loss and posed threats to public health. Over nearly two decades, with the antigenic changes in the diversified H5Ny viruses, the limited protective efficacy...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7348806/ https://www.ncbi.nlm.nih.gov/pubmed/32252383 http://dx.doi.org/10.3390/vaccines8020159 |
_version_ | 1783556916307296256 |
---|---|
author | Hoang, Hang Thi Thu Nguyen, Chi Hung Nguyen, Ngan Thi Thuy Pham, An Dang Nguyen, Hang Thi Thu Le, Thanh Hoa Tran, Hanh Xuan Chu, Ha Hoang Nguyen, Nam Trung |
author_facet | Hoang, Hang Thi Thu Nguyen, Chi Hung Nguyen, Ngan Thi Thuy Pham, An Dang Nguyen, Hang Thi Thu Le, Thanh Hoa Tran, Hanh Xuan Chu, Ha Hoang Nguyen, Nam Trung |
author_sort | Hoang, Hang Thi Thu |
collection | PubMed |
description | Vietnam is one of the countries most affected worldwide by the highly pathogenic avian influenza (HPAI) virus, which caused enormous economic loss and posed threats to public health. Over nearly two decades, with the antigenic changes in the diversified H5Ny viruses, the limited protective efficacy of the available vaccines was encountered. Therefore, it is necessary to approach a technology platform for the country to accelerate vaccine production that enables quick response to new influenza subtypes. This study utilized a powerful reverse genetics technique to successfully generate a recombinant H5N1 vaccine strain (designated as IBT-RG02) containing two surface proteins (haemagglutinin (HA) and neuraminidase (NA)) from the HPAI H5N1 (A/duck/Vietnam/HT2/2014(H5N1)) of the dominant clade 2.3.2.1c in Vietnam during 2012–2014. Importantly, the IBT-RG02 vaccine candidate has elicited high antibody titres in chickens (geometric mean titre (GMT) of 6.42 and 6.92, log(2) on day 14 and day 28 p.i., respectively). To test the efficacy, immunized chickens were challenged with the circulating virulent strains. As results, there was a high protection rate of 91.6% chickens against the virulent A/DK/VN/Bacninh/NCVD-17A384/2017 of the same clade and a cross-protection of 83.3% against A/duck/TG/NAVET(3)/2013 virus of clade 1.1. Our promising results showed that we can independently master the reverse genetics technology for generation of highly immunogenic vaccine candidates, and henceforth, it is a timely manner to reformulate avian influenza virus vaccines against variable H5 clade HPAI viruses in Vietnam. |
format | Online Article Text |
id | pubmed-7348806 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-73488062020-07-22 Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains Hoang, Hang Thi Thu Nguyen, Chi Hung Nguyen, Ngan Thi Thuy Pham, An Dang Nguyen, Hang Thi Thu Le, Thanh Hoa Tran, Hanh Xuan Chu, Ha Hoang Nguyen, Nam Trung Vaccines (Basel) Communication Vietnam is one of the countries most affected worldwide by the highly pathogenic avian influenza (HPAI) virus, which caused enormous economic loss and posed threats to public health. Over nearly two decades, with the antigenic changes in the diversified H5Ny viruses, the limited protective efficacy of the available vaccines was encountered. Therefore, it is necessary to approach a technology platform for the country to accelerate vaccine production that enables quick response to new influenza subtypes. This study utilized a powerful reverse genetics technique to successfully generate a recombinant H5N1 vaccine strain (designated as IBT-RG02) containing two surface proteins (haemagglutinin (HA) and neuraminidase (NA)) from the HPAI H5N1 (A/duck/Vietnam/HT2/2014(H5N1)) of the dominant clade 2.3.2.1c in Vietnam during 2012–2014. Importantly, the IBT-RG02 vaccine candidate has elicited high antibody titres in chickens (geometric mean titre (GMT) of 6.42 and 6.92, log(2) on day 14 and day 28 p.i., respectively). To test the efficacy, immunized chickens were challenged with the circulating virulent strains. As results, there was a high protection rate of 91.6% chickens against the virulent A/DK/VN/Bacninh/NCVD-17A384/2017 of the same clade and a cross-protection of 83.3% against A/duck/TG/NAVET(3)/2013 virus of clade 1.1. Our promising results showed that we can independently master the reverse genetics technology for generation of highly immunogenic vaccine candidates, and henceforth, it is a timely manner to reformulate avian influenza virus vaccines against variable H5 clade HPAI viruses in Vietnam. MDPI 2020-04-02 /pmc/articles/PMC7348806/ /pubmed/32252383 http://dx.doi.org/10.3390/vaccines8020159 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Communication Hoang, Hang Thi Thu Nguyen, Chi Hung Nguyen, Ngan Thi Thuy Pham, An Dang Nguyen, Hang Thi Thu Le, Thanh Hoa Tran, Hanh Xuan Chu, Ha Hoang Nguyen, Nam Trung Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains |
title | Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains |
title_full | Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains |
title_fullStr | Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains |
title_full_unstemmed | Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains |
title_short | Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains |
title_sort | immunization with the h5n1 recombinant vaccine candidate induces high protection in chickens against vietnamese highly pathogenic avian influenza virus strains |
topic | Communication |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7348806/ https://www.ncbi.nlm.nih.gov/pubmed/32252383 http://dx.doi.org/10.3390/vaccines8020159 |
work_keys_str_mv | AT hoanghangthithu immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains AT nguyenchihung immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains AT nguyennganthithuy immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains AT phamandang immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains AT nguyenhangthithu immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains AT lethanhhoa immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains AT tranhanhxuan immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains AT chuhahoang immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains AT nguyennamtrung immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains |