Cargando…

Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains

Vietnam is one of the countries most affected worldwide by the highly pathogenic avian influenza (HPAI) virus, which caused enormous economic loss and posed threats to public health. Over nearly two decades, with the antigenic changes in the diversified H5Ny viruses, the limited protective efficacy...

Descripción completa

Detalles Bibliográficos
Autores principales: Hoang, Hang Thi Thu, Nguyen, Chi Hung, Nguyen, Ngan Thi Thuy, Pham, An Dang, Nguyen, Hang Thi Thu, Le, Thanh Hoa, Tran, Hanh Xuan, Chu, Ha Hoang, Nguyen, Nam Trung
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7348806/
https://www.ncbi.nlm.nih.gov/pubmed/32252383
http://dx.doi.org/10.3390/vaccines8020159
_version_ 1783556916307296256
author Hoang, Hang Thi Thu
Nguyen, Chi Hung
Nguyen, Ngan Thi Thuy
Pham, An Dang
Nguyen, Hang Thi Thu
Le, Thanh Hoa
Tran, Hanh Xuan
Chu, Ha Hoang
Nguyen, Nam Trung
author_facet Hoang, Hang Thi Thu
Nguyen, Chi Hung
Nguyen, Ngan Thi Thuy
Pham, An Dang
Nguyen, Hang Thi Thu
Le, Thanh Hoa
Tran, Hanh Xuan
Chu, Ha Hoang
Nguyen, Nam Trung
author_sort Hoang, Hang Thi Thu
collection PubMed
description Vietnam is one of the countries most affected worldwide by the highly pathogenic avian influenza (HPAI) virus, which caused enormous economic loss and posed threats to public health. Over nearly two decades, with the antigenic changes in the diversified H5Ny viruses, the limited protective efficacy of the available vaccines was encountered. Therefore, it is necessary to approach a technology platform for the country to accelerate vaccine production that enables quick response to new influenza subtypes. This study utilized a powerful reverse genetics technique to successfully generate a recombinant H5N1 vaccine strain (designated as IBT-RG02) containing two surface proteins (haemagglutinin (HA) and neuraminidase (NA)) from the HPAI H5N1 (A/duck/Vietnam/HT2/2014(H5N1)) of the dominant clade 2.3.2.1c in Vietnam during 2012–2014. Importantly, the IBT-RG02 vaccine candidate has elicited high antibody titres in chickens (geometric mean titre (GMT) of 6.42 and 6.92, log(2) on day 14 and day 28 p.i., respectively). To test the efficacy, immunized chickens were challenged with the circulating virulent strains. As results, there was a high protection rate of 91.6% chickens against the virulent A/DK/VN/Bacninh/NCVD-17A384/2017 of the same clade and a cross-protection of 83.3% against A/duck/TG/NAVET(3)/2013 virus of clade 1.1. Our promising results showed that we can independently master the reverse genetics technology for generation of highly immunogenic vaccine candidates, and henceforth, it is a timely manner to reformulate avian influenza virus vaccines against variable H5 clade HPAI viruses in Vietnam.
format Online
Article
Text
id pubmed-7348806
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-73488062020-07-22 Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains Hoang, Hang Thi Thu Nguyen, Chi Hung Nguyen, Ngan Thi Thuy Pham, An Dang Nguyen, Hang Thi Thu Le, Thanh Hoa Tran, Hanh Xuan Chu, Ha Hoang Nguyen, Nam Trung Vaccines (Basel) Communication Vietnam is one of the countries most affected worldwide by the highly pathogenic avian influenza (HPAI) virus, which caused enormous economic loss and posed threats to public health. Over nearly two decades, with the antigenic changes in the diversified H5Ny viruses, the limited protective efficacy of the available vaccines was encountered. Therefore, it is necessary to approach a technology platform for the country to accelerate vaccine production that enables quick response to new influenza subtypes. This study utilized a powerful reverse genetics technique to successfully generate a recombinant H5N1 vaccine strain (designated as IBT-RG02) containing two surface proteins (haemagglutinin (HA) and neuraminidase (NA)) from the HPAI H5N1 (A/duck/Vietnam/HT2/2014(H5N1)) of the dominant clade 2.3.2.1c in Vietnam during 2012–2014. Importantly, the IBT-RG02 vaccine candidate has elicited high antibody titres in chickens (geometric mean titre (GMT) of 6.42 and 6.92, log(2) on day 14 and day 28 p.i., respectively). To test the efficacy, immunized chickens were challenged with the circulating virulent strains. As results, there was a high protection rate of 91.6% chickens against the virulent A/DK/VN/Bacninh/NCVD-17A384/2017 of the same clade and a cross-protection of 83.3% against A/duck/TG/NAVET(3)/2013 virus of clade 1.1. Our promising results showed that we can independently master the reverse genetics technology for generation of highly immunogenic vaccine candidates, and henceforth, it is a timely manner to reformulate avian influenza virus vaccines against variable H5 clade HPAI viruses in Vietnam. MDPI 2020-04-02 /pmc/articles/PMC7348806/ /pubmed/32252383 http://dx.doi.org/10.3390/vaccines8020159 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Communication
Hoang, Hang Thi Thu
Nguyen, Chi Hung
Nguyen, Ngan Thi Thuy
Pham, An Dang
Nguyen, Hang Thi Thu
Le, Thanh Hoa
Tran, Hanh Xuan
Chu, Ha Hoang
Nguyen, Nam Trung
Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains
title Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains
title_full Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains
title_fullStr Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains
title_full_unstemmed Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains
title_short Immunization with the H5N1 Recombinant Vaccine Candidate Induces High Protection in Chickens against Vietnamese Highly Pathogenic Avian Influenza Virus Strains
title_sort immunization with the h5n1 recombinant vaccine candidate induces high protection in chickens against vietnamese highly pathogenic avian influenza virus strains
topic Communication
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7348806/
https://www.ncbi.nlm.nih.gov/pubmed/32252383
http://dx.doi.org/10.3390/vaccines8020159
work_keys_str_mv AT hoanghangthithu immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains
AT nguyenchihung immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains
AT nguyennganthithuy immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains
AT phamandang immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains
AT nguyenhangthithu immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains
AT lethanhhoa immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains
AT tranhanhxuan immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains
AT chuhahoang immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains
AT nguyennamtrung immunizationwiththeh5n1recombinantvaccinecandidateinduceshighprotectioninchickensagainstvietnamesehighlypathogenicavianinfluenzavirusstrains