Cargando…
The CFTR Mutation c.3453G > C (D1152H) Confers an Anion Selectivity Defect in Primary Airway Tissue that Can be Rescued by Ivacaftor
The Cystic Fibrosis Transmembrane Conductance Regulator (CFTR) gene variant, c.3453G > C (D1152H), is associated with mild Cystic Fibrosis (CF) disease, though there is considerable clinical variability ranging from no detectable symptoms to lung disease with early acquisition of Pseudomonas aeru...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7354675/ https://www.ncbi.nlm.nih.gov/pubmed/32414100 http://dx.doi.org/10.3390/jpm10020040 |
_version_ | 1783558140548087808 |
---|---|
author | Laselva, Onofrio Moraes, Theo J. He, Gengming Bartlett, Claire Szàrics, Ida Ouyang, Hong Gunawardena, Tarini N. A. Strug, Lisa Bear, Christine E. Gonska, Tanja |
author_facet | Laselva, Onofrio Moraes, Theo J. He, Gengming Bartlett, Claire Szàrics, Ida Ouyang, Hong Gunawardena, Tarini N. A. Strug, Lisa Bear, Christine E. Gonska, Tanja |
author_sort | Laselva, Onofrio |
collection | PubMed |
description | The Cystic Fibrosis Transmembrane Conductance Regulator (CFTR) gene variant, c.3453G > C (D1152H), is associated with mild Cystic Fibrosis (CF) disease, though there is considerable clinical variability ranging from no detectable symptoms to lung disease with early acquisition of Pseudomonas aeruginosa. The approval extension of ivacaftor, the first CFTR modulator drug approved, to include D1152H was based on a positive drug response of defective CFTR-D1152H chloride channel function when expressed in FRT cells. Functional analyses of primary human nasal epithelial cells (HNE) from an individual homozygous for D1152H now revealed that while CFTR-D1152H demonstrated normal, wild-type level chloride conductance, its bicarbonate-selective conductance was impaired. Treatment with ivacaftor increased this bicarbonate-selective conductance. Extensive genetic, protein and functional analysis of the nasal cells of this D1152H/D1152H patient revealed a 90% reduction of CFTR transcripts due to the homozygous presence of the 5T polymorphism in the poly-T tract forming a complex allele with D1152H. Thus, we confirm previous observation in patient-derived tissue that 10% normal CFTR transcripts confer normal, wild-type level chloride channel activity. Together, this study highlights the benefit of patient-derived tissues to study the functional expression and pharmacological modulation of CF-causing mutations, in order to understand pathogenesis and therapeutic responses. |
format | Online Article Text |
id | pubmed-7354675 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-73546752020-07-23 The CFTR Mutation c.3453G > C (D1152H) Confers an Anion Selectivity Defect in Primary Airway Tissue that Can be Rescued by Ivacaftor Laselva, Onofrio Moraes, Theo J. He, Gengming Bartlett, Claire Szàrics, Ida Ouyang, Hong Gunawardena, Tarini N. A. Strug, Lisa Bear, Christine E. Gonska, Tanja J Pers Med Article The Cystic Fibrosis Transmembrane Conductance Regulator (CFTR) gene variant, c.3453G > C (D1152H), is associated with mild Cystic Fibrosis (CF) disease, though there is considerable clinical variability ranging from no detectable symptoms to lung disease with early acquisition of Pseudomonas aeruginosa. The approval extension of ivacaftor, the first CFTR modulator drug approved, to include D1152H was based on a positive drug response of defective CFTR-D1152H chloride channel function when expressed in FRT cells. Functional analyses of primary human nasal epithelial cells (HNE) from an individual homozygous for D1152H now revealed that while CFTR-D1152H demonstrated normal, wild-type level chloride conductance, its bicarbonate-selective conductance was impaired. Treatment with ivacaftor increased this bicarbonate-selective conductance. Extensive genetic, protein and functional analysis of the nasal cells of this D1152H/D1152H patient revealed a 90% reduction of CFTR transcripts due to the homozygous presence of the 5T polymorphism in the poly-T tract forming a complex allele with D1152H. Thus, we confirm previous observation in patient-derived tissue that 10% normal CFTR transcripts confer normal, wild-type level chloride channel activity. Together, this study highlights the benefit of patient-derived tissues to study the functional expression and pharmacological modulation of CF-causing mutations, in order to understand pathogenesis and therapeutic responses. MDPI 2020-05-13 /pmc/articles/PMC7354675/ /pubmed/32414100 http://dx.doi.org/10.3390/jpm10020040 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Laselva, Onofrio Moraes, Theo J. He, Gengming Bartlett, Claire Szàrics, Ida Ouyang, Hong Gunawardena, Tarini N. A. Strug, Lisa Bear, Christine E. Gonska, Tanja The CFTR Mutation c.3453G > C (D1152H) Confers an Anion Selectivity Defect in Primary Airway Tissue that Can be Rescued by Ivacaftor |
title | The CFTR Mutation c.3453G > C (D1152H) Confers an Anion Selectivity Defect in Primary Airway Tissue that Can be Rescued by Ivacaftor |
title_full | The CFTR Mutation c.3453G > C (D1152H) Confers an Anion Selectivity Defect in Primary Airway Tissue that Can be Rescued by Ivacaftor |
title_fullStr | The CFTR Mutation c.3453G > C (D1152H) Confers an Anion Selectivity Defect in Primary Airway Tissue that Can be Rescued by Ivacaftor |
title_full_unstemmed | The CFTR Mutation c.3453G > C (D1152H) Confers an Anion Selectivity Defect in Primary Airway Tissue that Can be Rescued by Ivacaftor |
title_short | The CFTR Mutation c.3453G > C (D1152H) Confers an Anion Selectivity Defect in Primary Airway Tissue that Can be Rescued by Ivacaftor |
title_sort | cftr mutation c.3453g > c (d1152h) confers an anion selectivity defect in primary airway tissue that can be rescued by ivacaftor |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7354675/ https://www.ncbi.nlm.nih.gov/pubmed/32414100 http://dx.doi.org/10.3390/jpm10020040 |
work_keys_str_mv | AT laselvaonofrio thecftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT moraestheoj thecftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT hegengming thecftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT bartlettclaire thecftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT szaricsida thecftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT ouyanghong thecftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT gunawardenatarinina thecftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT struglisa thecftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT bearchristinee thecftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT gonskatanja thecftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT laselvaonofrio cftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT moraestheoj cftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT hegengming cftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT bartlettclaire cftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT szaricsida cftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT ouyanghong cftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT gunawardenatarinina cftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT struglisa cftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT bearchristinee cftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor AT gonskatanja cftrmutationc3453gcd1152hconfersananionselectivitydefectinprimaryairwaytissuethatcanberescuedbyivacaftor |