Cargando…
Barriers to childhood immunization in sub-Saharan Africa: A systematic review
BACKGROUND: Immunization to prevent infectious diseases is a core strategy to improve childhood health as well as survival. It remains a challenge for some African countries to attain the required childhood immunization coverage. We aim at identifying individual barriers confronting parents/caretake...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7362649/ https://www.ncbi.nlm.nih.gov/pubmed/32664849 http://dx.doi.org/10.1186/s12889-020-09169-4 |
_version_ | 1783559533209059328 |
---|---|
author | Bangura, Joseph Benjamin Xiao, Shuiyuan Qiu, Dan Ouyang, Feiyun Chen, Lei |
author_facet | Bangura, Joseph Benjamin Xiao, Shuiyuan Qiu, Dan Ouyang, Feiyun Chen, Lei |
author_sort | Bangura, Joseph Benjamin |
collection | PubMed |
description | BACKGROUND: Immunization to prevent infectious diseases is a core strategy to improve childhood health as well as survival. It remains a challenge for some African countries to attain the required childhood immunization coverage. We aim at identifying individual barriers confronting parents/caretakers, providers, and health systems that hinder childhood immunization coverage in Sub-Saharan Africa. METHOD: This systematic review searched PubMed/MEDLINE, Web of Science and EMBASE. We restricted to published articles in English that focused on childhood immunization barriers in sub-Saharan Africa from January 1988 to December 2019. We excluded studies if: focused on barriers to immunization for children in other regions of the world, studied adult immunization barriers; studies not available on the university library, they were editorial, reports, reviews, supplement, and bulletins. Study designs included were cross-sectional, second-hand data analysis; and case control. RESULTS: Of the 2652 items identified, 48 met inclusion criteria. Parents/caretakers were the most common subjects. Nine articles were of moderate and 39 were of high methodological quality. Nine studies analyzed secondary data; 36 used cross-sectional designs and three employed case control method. Thirty studies reported national immunization coverage of key vaccines for children under one, eighteen did not. When reported, national immunization coverage of childhood vaccines is reported to be low. Parents/caretaker’ barriers included lack of knowledge of immunization, distance to access point, financial deprivation, lack of partners support, and distrust in vaccines and immunization programs. Other associated factors for low vaccine rates included the number of off-springs, lifestyle, migration, occupation and parent’s forgetfulness, inconvenient time and language barrier. Barriers at health system level cited by healthcare providers included limited human resources and inadequate infrastructures to maintain the cold chain and adequate supply of vaccines. CONCLUSION: In this review we identified more thoroughly the parents/caretakers’ barriers than those of providers and health systems. Factors that influenced decisions to get children vaccinated were mainly their gender, beliefs, socio-culture factors in the communities in which they live. Thus it is vital that immunization programs consider these barriers and address the people and societies in their communities across sub-Saharan Africa. |
format | Online Article Text |
id | pubmed-7362649 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-73626492020-07-20 Barriers to childhood immunization in sub-Saharan Africa: A systematic review Bangura, Joseph Benjamin Xiao, Shuiyuan Qiu, Dan Ouyang, Feiyun Chen, Lei BMC Public Health Research Article BACKGROUND: Immunization to prevent infectious diseases is a core strategy to improve childhood health as well as survival. It remains a challenge for some African countries to attain the required childhood immunization coverage. We aim at identifying individual barriers confronting parents/caretakers, providers, and health systems that hinder childhood immunization coverage in Sub-Saharan Africa. METHOD: This systematic review searched PubMed/MEDLINE, Web of Science and EMBASE. We restricted to published articles in English that focused on childhood immunization barriers in sub-Saharan Africa from January 1988 to December 2019. We excluded studies if: focused on barriers to immunization for children in other regions of the world, studied adult immunization barriers; studies not available on the university library, they were editorial, reports, reviews, supplement, and bulletins. Study designs included were cross-sectional, second-hand data analysis; and case control. RESULTS: Of the 2652 items identified, 48 met inclusion criteria. Parents/caretakers were the most common subjects. Nine articles were of moderate and 39 were of high methodological quality. Nine studies analyzed secondary data; 36 used cross-sectional designs and three employed case control method. Thirty studies reported national immunization coverage of key vaccines for children under one, eighteen did not. When reported, national immunization coverage of childhood vaccines is reported to be low. Parents/caretaker’ barriers included lack of knowledge of immunization, distance to access point, financial deprivation, lack of partners support, and distrust in vaccines and immunization programs. Other associated factors for low vaccine rates included the number of off-springs, lifestyle, migration, occupation and parent’s forgetfulness, inconvenient time and language barrier. Barriers at health system level cited by healthcare providers included limited human resources and inadequate infrastructures to maintain the cold chain and adequate supply of vaccines. CONCLUSION: In this review we identified more thoroughly the parents/caretakers’ barriers than those of providers and health systems. Factors that influenced decisions to get children vaccinated were mainly their gender, beliefs, socio-culture factors in the communities in which they live. Thus it is vital that immunization programs consider these barriers and address the people and societies in their communities across sub-Saharan Africa. BioMed Central 2020-07-14 /pmc/articles/PMC7362649/ /pubmed/32664849 http://dx.doi.org/10.1186/s12889-020-09169-4 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Article Bangura, Joseph Benjamin Xiao, Shuiyuan Qiu, Dan Ouyang, Feiyun Chen, Lei Barriers to childhood immunization in sub-Saharan Africa: A systematic review |
title | Barriers to childhood immunization in sub-Saharan Africa: A systematic review |
title_full | Barriers to childhood immunization in sub-Saharan Africa: A systematic review |
title_fullStr | Barriers to childhood immunization in sub-Saharan Africa: A systematic review |
title_full_unstemmed | Barriers to childhood immunization in sub-Saharan Africa: A systematic review |
title_short | Barriers to childhood immunization in sub-Saharan Africa: A systematic review |
title_sort | barriers to childhood immunization in sub-saharan africa: a systematic review |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7362649/ https://www.ncbi.nlm.nih.gov/pubmed/32664849 http://dx.doi.org/10.1186/s12889-020-09169-4 |
work_keys_str_mv | AT bangurajosephbenjamin barrierstochildhoodimmunizationinsubsaharanafricaasystematicreview AT xiaoshuiyuan barrierstochildhoodimmunizationinsubsaharanafricaasystematicreview AT qiudan barrierstochildhoodimmunizationinsubsaharanafricaasystematicreview AT ouyangfeiyun barrierstochildhoodimmunizationinsubsaharanafricaasystematicreview AT chenlei barrierstochildhoodimmunizationinsubsaharanafricaasystematicreview |