Cargando…
Maternal and perinatal outcomes and pharmacological management of Covid-19 infection in pregnancy: a systematic review protocol
BACKGROUND: Over 4.2 million confirmed cases and more than 285,000 deaths, COVID-19 pandemic continues to harm significant number of people worldwide. Several studies have reported the impact of COVID-19 in general population; however, there is scarcity of information related to pharmacological mana...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7368633/ https://www.ncbi.nlm.nih.gov/pubmed/32682444 http://dx.doi.org/10.1186/s13643-020-01418-2 |
_version_ | 1783560633533333504 |
---|---|
author | Thomas, Binny Pallivalapila, Abdulrouf El Kassem, Wessam Tarannum, Asma Al Hail, Fatema Rijims, Mohammed Parappil, Hussain Bayo, Arabo Ibrahim Ahmad, Shamsa Nazar, Zachariah Stewart, Derek Al Hail, Moza |
author_facet | Thomas, Binny Pallivalapila, Abdulrouf El Kassem, Wessam Tarannum, Asma Al Hail, Fatema Rijims, Mohammed Parappil, Hussain Bayo, Arabo Ibrahim Ahmad, Shamsa Nazar, Zachariah Stewart, Derek Al Hail, Moza |
author_sort | Thomas, Binny |
collection | PubMed |
description | BACKGROUND: Over 4.2 million confirmed cases and more than 285,000 deaths, COVID-19 pandemic continues to harm significant number of people worldwide. Several studies have reported the impact of COVID-19 in general population; however, there is scarcity of information related to pharmacological management and maternal and perinatal outcomes during the pandemic. Altered physiological, anatomical, and immunological response during pregnancy makes it more susceptible to infections. Furthermore, during pregnancy, a woman undergoes multiple interactions with the health care system that increases her chance of getting infected; therefore, managing pregnant population presents a unique challenge. RESEARCH QUESTIONS: What are the different clinical characteristics presented in maternal and perinatal population? What are the different maternal and perinatal outcome measures reported? What are the distinct therapeutic interventions reported to treat COVID-19? Is it safe to use “medications” used in the treatment of COVID-19 during antenatal, perinatal, postnatal, and breastfeeding? METHOD: The search will follow a comprehensive, sequential three step search strategy. Several databases relevant to COVID-19 and its impact on pregnancy including Medline, CINAHL, and LitCovid will be searched from the inception of the disease until the completion of data collection. The quality of this search strategy will be assessed using Peer Review of Electronic Search Strategies Evidence-Based Checklist (PRESS EBC). An eligibility form will be developed for a transparent screening and inclusion/exclusion of studies. All studies will be sent to RefWorks, and abstraction will be independently performed by two researchers. Risk of bias will be assessed using Cochrane Risk of Bias tool for randomized controlled trials, Newcastle–Ottawa Quality Assessment Scale for non-randomized studies, and for case reports, Murad et al. tool will be used. Decision to conduct meta-analysis will be based on several factors including homogeneity and outcome measures reported; otherwise, a narrative synthesis will be deemed appropriate. DISCUSSION: This systematic review will summarize the existing data on effect of COVID-19 on maternal and perinatal population. Furthermore, to the best of our knowledge, this is the first systematic review addressing therapeutic management and safety of medicines to treat COVID-19 during pregnancy and breastfeeding. SYSTEMATIC REVIEW REGISTRATION: This systematic review has been registered and published with Prospero (CRD42020172773). |
format | Online Article Text |
id | pubmed-7368633 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-73686332020-07-20 Maternal and perinatal outcomes and pharmacological management of Covid-19 infection in pregnancy: a systematic review protocol Thomas, Binny Pallivalapila, Abdulrouf El Kassem, Wessam Tarannum, Asma Al Hail, Fatema Rijims, Mohammed Parappil, Hussain Bayo, Arabo Ibrahim Ahmad, Shamsa Nazar, Zachariah Stewart, Derek Al Hail, Moza Syst Rev Protocol BACKGROUND: Over 4.2 million confirmed cases and more than 285,000 deaths, COVID-19 pandemic continues to harm significant number of people worldwide. Several studies have reported the impact of COVID-19 in general population; however, there is scarcity of information related to pharmacological management and maternal and perinatal outcomes during the pandemic. Altered physiological, anatomical, and immunological response during pregnancy makes it more susceptible to infections. Furthermore, during pregnancy, a woman undergoes multiple interactions with the health care system that increases her chance of getting infected; therefore, managing pregnant population presents a unique challenge. RESEARCH QUESTIONS: What are the different clinical characteristics presented in maternal and perinatal population? What are the different maternal and perinatal outcome measures reported? What are the distinct therapeutic interventions reported to treat COVID-19? Is it safe to use “medications” used in the treatment of COVID-19 during antenatal, perinatal, postnatal, and breastfeeding? METHOD: The search will follow a comprehensive, sequential three step search strategy. Several databases relevant to COVID-19 and its impact on pregnancy including Medline, CINAHL, and LitCovid will be searched from the inception of the disease until the completion of data collection. The quality of this search strategy will be assessed using Peer Review of Electronic Search Strategies Evidence-Based Checklist (PRESS EBC). An eligibility form will be developed for a transparent screening and inclusion/exclusion of studies. All studies will be sent to RefWorks, and abstraction will be independently performed by two researchers. Risk of bias will be assessed using Cochrane Risk of Bias tool for randomized controlled trials, Newcastle–Ottawa Quality Assessment Scale for non-randomized studies, and for case reports, Murad et al. tool will be used. Decision to conduct meta-analysis will be based on several factors including homogeneity and outcome measures reported; otherwise, a narrative synthesis will be deemed appropriate. DISCUSSION: This systematic review will summarize the existing data on effect of COVID-19 on maternal and perinatal population. Furthermore, to the best of our knowledge, this is the first systematic review addressing therapeutic management and safety of medicines to treat COVID-19 during pregnancy and breastfeeding. SYSTEMATIC REVIEW REGISTRATION: This systematic review has been registered and published with Prospero (CRD42020172773). BioMed Central 2020-07-18 /pmc/articles/PMC7368633/ /pubmed/32682444 http://dx.doi.org/10.1186/s13643-020-01418-2 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Protocol Thomas, Binny Pallivalapila, Abdulrouf El Kassem, Wessam Tarannum, Asma Al Hail, Fatema Rijims, Mohammed Parappil, Hussain Bayo, Arabo Ibrahim Ahmad, Shamsa Nazar, Zachariah Stewart, Derek Al Hail, Moza Maternal and perinatal outcomes and pharmacological management of Covid-19 infection in pregnancy: a systematic review protocol |
title | Maternal and perinatal outcomes and pharmacological management of Covid-19 infection in pregnancy: a systematic review protocol |
title_full | Maternal and perinatal outcomes and pharmacological management of Covid-19 infection in pregnancy: a systematic review protocol |
title_fullStr | Maternal and perinatal outcomes and pharmacological management of Covid-19 infection in pregnancy: a systematic review protocol |
title_full_unstemmed | Maternal and perinatal outcomes and pharmacological management of Covid-19 infection in pregnancy: a systematic review protocol |
title_short | Maternal and perinatal outcomes and pharmacological management of Covid-19 infection in pregnancy: a systematic review protocol |
title_sort | maternal and perinatal outcomes and pharmacological management of covid-19 infection in pregnancy: a systematic review protocol |
topic | Protocol |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7368633/ https://www.ncbi.nlm.nih.gov/pubmed/32682444 http://dx.doi.org/10.1186/s13643-020-01418-2 |
work_keys_str_mv | AT thomasbinny maternalandperinataloutcomesandpharmacologicalmanagementofcovid19infectioninpregnancyasystematicreviewprotocol AT pallivalapilaabdulrouf maternalandperinataloutcomesandpharmacologicalmanagementofcovid19infectioninpregnancyasystematicreviewprotocol AT elkassemwessam maternalandperinataloutcomesandpharmacologicalmanagementofcovid19infectioninpregnancyasystematicreviewprotocol AT tarannumasma maternalandperinataloutcomesandpharmacologicalmanagementofcovid19infectioninpregnancyasystematicreviewprotocol AT alhailfatema maternalandperinataloutcomesandpharmacologicalmanagementofcovid19infectioninpregnancyasystematicreviewprotocol AT rijimsmohammed maternalandperinataloutcomesandpharmacologicalmanagementofcovid19infectioninpregnancyasystematicreviewprotocol AT parappilhussain maternalandperinataloutcomesandpharmacologicalmanagementofcovid19infectioninpregnancyasystematicreviewprotocol AT bayoaraboibrahim maternalandperinataloutcomesandpharmacologicalmanagementofcovid19infectioninpregnancyasystematicreviewprotocol AT ahmadshamsa maternalandperinataloutcomesandpharmacologicalmanagementofcovid19infectioninpregnancyasystematicreviewprotocol AT nazarzachariah maternalandperinataloutcomesandpharmacologicalmanagementofcovid19infectioninpregnancyasystematicreviewprotocol AT stewartderek maternalandperinataloutcomesandpharmacologicalmanagementofcovid19infectioninpregnancyasystematicreviewprotocol AT alhailmoza maternalandperinataloutcomesandpharmacologicalmanagementofcovid19infectioninpregnancyasystematicreviewprotocol |