Cargando…
First-line cetuximab improves the efficacy of subsequent bevacizumab for RAS wild-type left-sided metastatic colorectal cancer: an observational retrospective study
The optimal targeted therapy sequence in patients of RAS wild-type left-sided metastatic colorectal cancer (mCRC) remains controversial, and few studies focus on the impact of first-line targeted agents on second-line ones. We enrolled 101 left-sided mCRC patients with RAS wild-type status, of which...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7378223/ https://www.ncbi.nlm.nih.gov/pubmed/32704062 http://dx.doi.org/10.1038/s41598-020-69230-5 |
_version_ | 1783562369354432512 |
---|---|
author | Liu, Shousheng Jiang, Chang Yang, Lin Huang, Jinsheng Peng, Roujun Wang, Xiaopai He, Wenzhuo Bai, Long Zhou, Yixin Zhang, Bei Xia, Liangping |
author_facet | Liu, Shousheng Jiang, Chang Yang, Lin Huang, Jinsheng Peng, Roujun Wang, Xiaopai He, Wenzhuo Bai, Long Zhou, Yixin Zhang, Bei Xia, Liangping |
author_sort | Liu, Shousheng |
collection | PubMed |
description | The optimal targeted therapy sequence in patients of RAS wild-type left-sided metastatic colorectal cancer (mCRC) remains controversial, and few studies focus on the impact of first-line targeted agents on second-line ones. We enrolled 101 left-sided mCRC patients with RAS wild-type status, of which 50 cases received bevacizumab plus chemotherapy in both first-line and second-line therapies (Group A) and 51 cases received first-line cetuximab plus chemotherapy followed by second-line bevacizumab-containing regimens (Group B). The progression free survival (PFS) and overall survival (OS) from start of first-line (PFS 1nd and OS 1nd) and second-line (PFS 2nd and OS 2nd) therapy were compared between the two groups. PFS 1nd was comparable (10.0 vs 10.4 months; p = 0.402), while PFS 2nd (4.6 vs 7.9 months; p = 0.002), OS 1nd (26.8 vs 40.0 months; p = 0.011), and OS 2nd (15.2 vs 22.3 months; p = 0.006) were all poorer in group A compared with group B. Our study in combination with previous clinical data suggest that first-line application of cetuximab may provide a favorable condition for promoting the effect of subsequent bevacizumab, thus representing the optimal targeted therapy sequence in patients of RAS wild-type left-sided mCRC. |
format | Online Article Text |
id | pubmed-7378223 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-73782232020-07-24 First-line cetuximab improves the efficacy of subsequent bevacizumab for RAS wild-type left-sided metastatic colorectal cancer: an observational retrospective study Liu, Shousheng Jiang, Chang Yang, Lin Huang, Jinsheng Peng, Roujun Wang, Xiaopai He, Wenzhuo Bai, Long Zhou, Yixin Zhang, Bei Xia, Liangping Sci Rep Article The optimal targeted therapy sequence in patients of RAS wild-type left-sided metastatic colorectal cancer (mCRC) remains controversial, and few studies focus on the impact of first-line targeted agents on second-line ones. We enrolled 101 left-sided mCRC patients with RAS wild-type status, of which 50 cases received bevacizumab plus chemotherapy in both first-line and second-line therapies (Group A) and 51 cases received first-line cetuximab plus chemotherapy followed by second-line bevacizumab-containing regimens (Group B). The progression free survival (PFS) and overall survival (OS) from start of first-line (PFS 1nd and OS 1nd) and second-line (PFS 2nd and OS 2nd) therapy were compared between the two groups. PFS 1nd was comparable (10.0 vs 10.4 months; p = 0.402), while PFS 2nd (4.6 vs 7.9 months; p = 0.002), OS 1nd (26.8 vs 40.0 months; p = 0.011), and OS 2nd (15.2 vs 22.3 months; p = 0.006) were all poorer in group A compared with group B. Our study in combination with previous clinical data suggest that first-line application of cetuximab may provide a favorable condition for promoting the effect of subsequent bevacizumab, thus representing the optimal targeted therapy sequence in patients of RAS wild-type left-sided mCRC. Nature Publishing Group UK 2020-07-23 /pmc/articles/PMC7378223/ /pubmed/32704062 http://dx.doi.org/10.1038/s41598-020-69230-5 Text en © The Author(s) 2020 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Article Liu, Shousheng Jiang, Chang Yang, Lin Huang, Jinsheng Peng, Roujun Wang, Xiaopai He, Wenzhuo Bai, Long Zhou, Yixin Zhang, Bei Xia, Liangping First-line cetuximab improves the efficacy of subsequent bevacizumab for RAS wild-type left-sided metastatic colorectal cancer: an observational retrospective study |
title | First-line cetuximab improves the efficacy of subsequent bevacizumab for RAS wild-type left-sided metastatic colorectal cancer: an observational retrospective study |
title_full | First-line cetuximab improves the efficacy of subsequent bevacizumab for RAS wild-type left-sided metastatic colorectal cancer: an observational retrospective study |
title_fullStr | First-line cetuximab improves the efficacy of subsequent bevacizumab for RAS wild-type left-sided metastatic colorectal cancer: an observational retrospective study |
title_full_unstemmed | First-line cetuximab improves the efficacy of subsequent bevacizumab for RAS wild-type left-sided metastatic colorectal cancer: an observational retrospective study |
title_short | First-line cetuximab improves the efficacy of subsequent bevacizumab for RAS wild-type left-sided metastatic colorectal cancer: an observational retrospective study |
title_sort | first-line cetuximab improves the efficacy of subsequent bevacizumab for ras wild-type left-sided metastatic colorectal cancer: an observational retrospective study |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7378223/ https://www.ncbi.nlm.nih.gov/pubmed/32704062 http://dx.doi.org/10.1038/s41598-020-69230-5 |
work_keys_str_mv | AT liushousheng firstlinecetuximabimprovestheefficacyofsubsequentbevacizumabforraswildtypeleftsidedmetastaticcolorectalcanceranobservationalretrospectivestudy AT jiangchang firstlinecetuximabimprovestheefficacyofsubsequentbevacizumabforraswildtypeleftsidedmetastaticcolorectalcanceranobservationalretrospectivestudy AT yanglin firstlinecetuximabimprovestheefficacyofsubsequentbevacizumabforraswildtypeleftsidedmetastaticcolorectalcanceranobservationalretrospectivestudy AT huangjinsheng firstlinecetuximabimprovestheefficacyofsubsequentbevacizumabforraswildtypeleftsidedmetastaticcolorectalcanceranobservationalretrospectivestudy AT pengroujun firstlinecetuximabimprovestheefficacyofsubsequentbevacizumabforraswildtypeleftsidedmetastaticcolorectalcanceranobservationalretrospectivestudy AT wangxiaopai firstlinecetuximabimprovestheefficacyofsubsequentbevacizumabforraswildtypeleftsidedmetastaticcolorectalcanceranobservationalretrospectivestudy AT hewenzhuo firstlinecetuximabimprovestheefficacyofsubsequentbevacizumabforraswildtypeleftsidedmetastaticcolorectalcanceranobservationalretrospectivestudy AT bailong firstlinecetuximabimprovestheefficacyofsubsequentbevacizumabforraswildtypeleftsidedmetastaticcolorectalcanceranobservationalretrospectivestudy AT zhouyixin firstlinecetuximabimprovestheefficacyofsubsequentbevacizumabforraswildtypeleftsidedmetastaticcolorectalcanceranobservationalretrospectivestudy AT zhangbei firstlinecetuximabimprovestheefficacyofsubsequentbevacizumabforraswildtypeleftsidedmetastaticcolorectalcanceranobservationalretrospectivestudy AT xialiangping firstlinecetuximabimprovestheefficacyofsubsequentbevacizumabforraswildtypeleftsidedmetastaticcolorectalcanceranobservationalretrospectivestudy |