Cargando…
Tn-Seq Analysis Identifies Genes Important for Yersinia pestis Adherence during Primary Pneumonic Plague
Following inhalation, Yersinia pestis rapidly colonizes the lung to establish infection during primary pneumonic plague. Although several adhesins have been identified in Yersinia spp., the factors mediating early Y. pestis adherence in the lung remain unknown. To identify genes important for Y. pes...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
American Society for Microbiology
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7407073/ https://www.ncbi.nlm.nih.gov/pubmed/32759339 http://dx.doi.org/10.1128/mSphere.00715-20 |
_version_ | 1783567541360132096 |
---|---|
author | Eichelberger, Kara R. Sepúlveda, Victoria E. Ford, John Selitsky, Sara R. Mieczkowski, Piotr A. Parker, Joel S. Goldman, William E. |
author_facet | Eichelberger, Kara R. Sepúlveda, Victoria E. Ford, John Selitsky, Sara R. Mieczkowski, Piotr A. Parker, Joel S. Goldman, William E. |
author_sort | Eichelberger, Kara R. |
collection | PubMed |
description | Following inhalation, Yersinia pestis rapidly colonizes the lung to establish infection during primary pneumonic plague. Although several adhesins have been identified in Yersinia spp., the factors mediating early Y. pestis adherence in the lung remain unknown. To identify genes important for Y. pestis adherence during primary pneumonic plague, we used transposon insertion sequencing (Tn-seq). Wild-type and capsule mutant (Δcaf1) Y. pestis transposon mutant libraries were serially passaged in vivo to enrich for nonadherent mutants in the lung using a mouse model of primary pneumonic plague. Sequencing of the passaged libraries revealed six mutants that were significantly enriched in both the wild-type and Δcaf1 Y. pestis backgrounds. The enriched mutants had insertions in genes that encode transcriptional regulators, chaperones, an endoribonuclease, and YPO3903, a hypothetical protein. Using single-strain infections and a transcriptional analysis, we identified a significant role for YPO3903 in Y. pestis adherence in the lung and showed that YPO3903 regulated transcript levels of psaA, which encodes a fimbria previously implicated in Y. pestis adherence in vitro. Deletion of psaA had a minor effect on Y. pestis adherence in the lung, suggesting that YPO3903 regulates other adhesins in addition to psaA. By enriching for mutations in genes that regulate the expression or assembly of multiple genes or proteins, we obtained screen results indicating that there may be not just one dominant adhesin but rather several factors that contribute to early Y. pestis adherence during primary pneumonic plague. IMPORTANCE Colonization of the lung by Yersinia pestis is a critical first step in establishing infection during primary pneumonic plague, a disease characterized by high lethality. However, the mechanisms by which Y. pestis adheres in the lung after inhalation remain elusive. Here, we used Tn-seq to identify Y. pestis genes important for adherence early during primary pneumonic plague. Our mutant enrichment strategy resulted in the identification of genes important for regulation and assembly of genes and proteins rather than adhesin genes themselves. These results reveal that there may be multiple Y. pestis adhesins or redundancy among adhesins. Identifying the adhesins regulated by the genes identified in our enrichment screen may reveal novel therapeutic targets for preventing Y. pestis adherence and the subsequent development of pneumonic plague. |
format | Online Article Text |
id | pubmed-7407073 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | American Society for Microbiology |
record_format | MEDLINE/PubMed |
spelling | pubmed-74070732020-08-11 Tn-Seq Analysis Identifies Genes Important for Yersinia pestis Adherence during Primary Pneumonic Plague Eichelberger, Kara R. Sepúlveda, Victoria E. Ford, John Selitsky, Sara R. Mieczkowski, Piotr A. Parker, Joel S. Goldman, William E. mSphere Research Article Following inhalation, Yersinia pestis rapidly colonizes the lung to establish infection during primary pneumonic plague. Although several adhesins have been identified in Yersinia spp., the factors mediating early Y. pestis adherence in the lung remain unknown. To identify genes important for Y. pestis adherence during primary pneumonic plague, we used transposon insertion sequencing (Tn-seq). Wild-type and capsule mutant (Δcaf1) Y. pestis transposon mutant libraries were serially passaged in vivo to enrich for nonadherent mutants in the lung using a mouse model of primary pneumonic plague. Sequencing of the passaged libraries revealed six mutants that were significantly enriched in both the wild-type and Δcaf1 Y. pestis backgrounds. The enriched mutants had insertions in genes that encode transcriptional regulators, chaperones, an endoribonuclease, and YPO3903, a hypothetical protein. Using single-strain infections and a transcriptional analysis, we identified a significant role for YPO3903 in Y. pestis adherence in the lung and showed that YPO3903 regulated transcript levels of psaA, which encodes a fimbria previously implicated in Y. pestis adherence in vitro. Deletion of psaA had a minor effect on Y. pestis adherence in the lung, suggesting that YPO3903 regulates other adhesins in addition to psaA. By enriching for mutations in genes that regulate the expression or assembly of multiple genes or proteins, we obtained screen results indicating that there may be not just one dominant adhesin but rather several factors that contribute to early Y. pestis adherence during primary pneumonic plague. IMPORTANCE Colonization of the lung by Yersinia pestis is a critical first step in establishing infection during primary pneumonic plague, a disease characterized by high lethality. However, the mechanisms by which Y. pestis adheres in the lung after inhalation remain elusive. Here, we used Tn-seq to identify Y. pestis genes important for adherence early during primary pneumonic plague. Our mutant enrichment strategy resulted in the identification of genes important for regulation and assembly of genes and proteins rather than adhesin genes themselves. These results reveal that there may be multiple Y. pestis adhesins or redundancy among adhesins. Identifying the adhesins regulated by the genes identified in our enrichment screen may reveal novel therapeutic targets for preventing Y. pestis adherence and the subsequent development of pneumonic plague. American Society for Microbiology 2020-08-05 /pmc/articles/PMC7407073/ /pubmed/32759339 http://dx.doi.org/10.1128/mSphere.00715-20 Text en Copyright © 2020 Eichelberger et al. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution 4.0 International license (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Research Article Eichelberger, Kara R. Sepúlveda, Victoria E. Ford, John Selitsky, Sara R. Mieczkowski, Piotr A. Parker, Joel S. Goldman, William E. Tn-Seq Analysis Identifies Genes Important for Yersinia pestis Adherence during Primary Pneumonic Plague |
title | Tn-Seq Analysis Identifies Genes Important for Yersinia pestis Adherence during Primary Pneumonic Plague |
title_full | Tn-Seq Analysis Identifies Genes Important for Yersinia pestis Adherence during Primary Pneumonic Plague |
title_fullStr | Tn-Seq Analysis Identifies Genes Important for Yersinia pestis Adherence during Primary Pneumonic Plague |
title_full_unstemmed | Tn-Seq Analysis Identifies Genes Important for Yersinia pestis Adherence during Primary Pneumonic Plague |
title_short | Tn-Seq Analysis Identifies Genes Important for Yersinia pestis Adherence during Primary Pneumonic Plague |
title_sort | tn-seq analysis identifies genes important for yersinia pestis adherence during primary pneumonic plague |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7407073/ https://www.ncbi.nlm.nih.gov/pubmed/32759339 http://dx.doi.org/10.1128/mSphere.00715-20 |
work_keys_str_mv | AT eichelbergerkarar tnseqanalysisidentifiesgenesimportantforyersiniapestisadherenceduringprimarypneumonicplague AT sepulvedavictoriae tnseqanalysisidentifiesgenesimportantforyersiniapestisadherenceduringprimarypneumonicplague AT fordjohn tnseqanalysisidentifiesgenesimportantforyersiniapestisadherenceduringprimarypneumonicplague AT selitskysarar tnseqanalysisidentifiesgenesimportantforyersiniapestisadherenceduringprimarypneumonicplague AT mieczkowskipiotra tnseqanalysisidentifiesgenesimportantforyersiniapestisadherenceduringprimarypneumonicplague AT parkerjoels tnseqanalysisidentifiesgenesimportantforyersiniapestisadherenceduringprimarypneumonicplague AT goldmanwilliame tnseqanalysisidentifiesgenesimportantforyersiniapestisadherenceduringprimarypneumonicplague |