Cargando…
The Gintonin-Enriched Fraction of Ginseng Regulates Lipid Metabolism and Browning via the cAMP-Protein Kinase a Signaling Pathway in Mice White Adipocytes
Obesity is a major health concern and is becoming an increasingly serious societal problem worldwide. The browning of white adipocytes has received considerable attention because of its potential protective effect against obesity-related metabolic disease. The gintonin-enriched fraction (GEF) is a n...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7407952/ https://www.ncbi.nlm.nih.gov/pubmed/32679738 http://dx.doi.org/10.3390/biom10071048 |
_version_ | 1783567724777046016 |
---|---|
author | Lee, Kippeum Jin, Heegu Chei, Sungwoo Oh, Hyun-Ji Choi, Sun-Hye Nah, Seung-Yeol Lee, Boo-Yong |
author_facet | Lee, Kippeum Jin, Heegu Chei, Sungwoo Oh, Hyun-Ji Choi, Sun-Hye Nah, Seung-Yeol Lee, Boo-Yong |
author_sort | Lee, Kippeum |
collection | PubMed |
description | Obesity is a major health concern and is becoming an increasingly serious societal problem worldwide. The browning of white adipocytes has received considerable attention because of its potential protective effect against obesity-related metabolic disease. The gintonin-enriched fraction (GEF) is a non-saponin, glycolipoprotein component of ginseng that is known to have neuroprotective and anti-inflammatory effects. However, the anti-obesity and browning effects of GEF have not been explored to date. Therefore, we aimed to determine whether GEF has a preventive effect against obesity. We differentiated 3T3-L1 cells and mouse primary subcutaneous adipocytes for 8 days in the presence or absence of GEF, and then measured the expression of intermediates in signaling pathways that regulate triglyceride (TG) synthesis and browning by Western blotting and immunofluorescence analysis. We found that GEF reduced lipid accumulation by reducing the expression of pro-adipogenic and lipogenic factors, and increased lipolysis and thermogenesis, which may be mediated by an increase in the phosphorylation of protein kinase A. These findings suggest that GEF may induce fat metabolism and energy expenditure in white adipocytes and therefore may represent a potential treatment for obesity. |
format | Online Article Text |
id | pubmed-7407952 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-74079522020-08-12 The Gintonin-Enriched Fraction of Ginseng Regulates Lipid Metabolism and Browning via the cAMP-Protein Kinase a Signaling Pathway in Mice White Adipocytes Lee, Kippeum Jin, Heegu Chei, Sungwoo Oh, Hyun-Ji Choi, Sun-Hye Nah, Seung-Yeol Lee, Boo-Yong Biomolecules Article Obesity is a major health concern and is becoming an increasingly serious societal problem worldwide. The browning of white adipocytes has received considerable attention because of its potential protective effect against obesity-related metabolic disease. The gintonin-enriched fraction (GEF) is a non-saponin, glycolipoprotein component of ginseng that is known to have neuroprotective and anti-inflammatory effects. However, the anti-obesity and browning effects of GEF have not been explored to date. Therefore, we aimed to determine whether GEF has a preventive effect against obesity. We differentiated 3T3-L1 cells and mouse primary subcutaneous adipocytes for 8 days in the presence or absence of GEF, and then measured the expression of intermediates in signaling pathways that regulate triglyceride (TG) synthesis and browning by Western blotting and immunofluorescence analysis. We found that GEF reduced lipid accumulation by reducing the expression of pro-adipogenic and lipogenic factors, and increased lipolysis and thermogenesis, which may be mediated by an increase in the phosphorylation of protein kinase A. These findings suggest that GEF may induce fat metabolism and energy expenditure in white adipocytes and therefore may represent a potential treatment for obesity. MDPI 2020-07-15 /pmc/articles/PMC7407952/ /pubmed/32679738 http://dx.doi.org/10.3390/biom10071048 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Lee, Kippeum Jin, Heegu Chei, Sungwoo Oh, Hyun-Ji Choi, Sun-Hye Nah, Seung-Yeol Lee, Boo-Yong The Gintonin-Enriched Fraction of Ginseng Regulates Lipid Metabolism and Browning via the cAMP-Protein Kinase a Signaling Pathway in Mice White Adipocytes |
title | The Gintonin-Enriched Fraction of Ginseng Regulates Lipid Metabolism and Browning via the cAMP-Protein Kinase a Signaling Pathway in Mice White Adipocytes |
title_full | The Gintonin-Enriched Fraction of Ginseng Regulates Lipid Metabolism and Browning via the cAMP-Protein Kinase a Signaling Pathway in Mice White Adipocytes |
title_fullStr | The Gintonin-Enriched Fraction of Ginseng Regulates Lipid Metabolism and Browning via the cAMP-Protein Kinase a Signaling Pathway in Mice White Adipocytes |
title_full_unstemmed | The Gintonin-Enriched Fraction of Ginseng Regulates Lipid Metabolism and Browning via the cAMP-Protein Kinase a Signaling Pathway in Mice White Adipocytes |
title_short | The Gintonin-Enriched Fraction of Ginseng Regulates Lipid Metabolism and Browning via the cAMP-Protein Kinase a Signaling Pathway in Mice White Adipocytes |
title_sort | gintonin-enriched fraction of ginseng regulates lipid metabolism and browning via the camp-protein kinase a signaling pathway in mice white adipocytes |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7407952/ https://www.ncbi.nlm.nih.gov/pubmed/32679738 http://dx.doi.org/10.3390/biom10071048 |
work_keys_str_mv | AT leekippeum thegintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes AT jinheegu thegintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes AT cheisungwoo thegintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes AT ohhyunji thegintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes AT choisunhye thegintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes AT nahseungyeol thegintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes AT leebooyong thegintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes AT leekippeum gintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes AT jinheegu gintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes AT cheisungwoo gintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes AT ohhyunji gintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes AT choisunhye gintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes AT nahseungyeol gintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes AT leebooyong gintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes |