Cargando…

The Gintonin-Enriched Fraction of Ginseng Regulates Lipid Metabolism and Browning via the cAMP-Protein Kinase a Signaling Pathway in Mice White Adipocytes

Obesity is a major health concern and is becoming an increasingly serious societal problem worldwide. The browning of white adipocytes has received considerable attention because of its potential protective effect against obesity-related metabolic disease. The gintonin-enriched fraction (GEF) is a n...

Descripción completa

Detalles Bibliográficos
Autores principales: Lee, Kippeum, Jin, Heegu, Chei, Sungwoo, Oh, Hyun-Ji, Choi, Sun-Hye, Nah, Seung-Yeol, Lee, Boo-Yong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7407952/
https://www.ncbi.nlm.nih.gov/pubmed/32679738
http://dx.doi.org/10.3390/biom10071048
_version_ 1783567724777046016
author Lee, Kippeum
Jin, Heegu
Chei, Sungwoo
Oh, Hyun-Ji
Choi, Sun-Hye
Nah, Seung-Yeol
Lee, Boo-Yong
author_facet Lee, Kippeum
Jin, Heegu
Chei, Sungwoo
Oh, Hyun-Ji
Choi, Sun-Hye
Nah, Seung-Yeol
Lee, Boo-Yong
author_sort Lee, Kippeum
collection PubMed
description Obesity is a major health concern and is becoming an increasingly serious societal problem worldwide. The browning of white adipocytes has received considerable attention because of its potential protective effect against obesity-related metabolic disease. The gintonin-enriched fraction (GEF) is a non-saponin, glycolipoprotein component of ginseng that is known to have neuroprotective and anti-inflammatory effects. However, the anti-obesity and browning effects of GEF have not been explored to date. Therefore, we aimed to determine whether GEF has a preventive effect against obesity. We differentiated 3T3-L1 cells and mouse primary subcutaneous adipocytes for 8 days in the presence or absence of GEF, and then measured the expression of intermediates in signaling pathways that regulate triglyceride (TG) synthesis and browning by Western blotting and immunofluorescence analysis. We found that GEF reduced lipid accumulation by reducing the expression of pro-adipogenic and lipogenic factors, and increased lipolysis and thermogenesis, which may be mediated by an increase in the phosphorylation of protein kinase A. These findings suggest that GEF may induce fat metabolism and energy expenditure in white adipocytes and therefore may represent a potential treatment for obesity.
format Online
Article
Text
id pubmed-7407952
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-74079522020-08-12 The Gintonin-Enriched Fraction of Ginseng Regulates Lipid Metabolism and Browning via the cAMP-Protein Kinase a Signaling Pathway in Mice White Adipocytes Lee, Kippeum Jin, Heegu Chei, Sungwoo Oh, Hyun-Ji Choi, Sun-Hye Nah, Seung-Yeol Lee, Boo-Yong Biomolecules Article Obesity is a major health concern and is becoming an increasingly serious societal problem worldwide. The browning of white adipocytes has received considerable attention because of its potential protective effect against obesity-related metabolic disease. The gintonin-enriched fraction (GEF) is a non-saponin, glycolipoprotein component of ginseng that is known to have neuroprotective and anti-inflammatory effects. However, the anti-obesity and browning effects of GEF have not been explored to date. Therefore, we aimed to determine whether GEF has a preventive effect against obesity. We differentiated 3T3-L1 cells and mouse primary subcutaneous adipocytes for 8 days in the presence or absence of GEF, and then measured the expression of intermediates in signaling pathways that regulate triglyceride (TG) synthesis and browning by Western blotting and immunofluorescence analysis. We found that GEF reduced lipid accumulation by reducing the expression of pro-adipogenic and lipogenic factors, and increased lipolysis and thermogenesis, which may be mediated by an increase in the phosphorylation of protein kinase A. These findings suggest that GEF may induce fat metabolism and energy expenditure in white adipocytes and therefore may represent a potential treatment for obesity. MDPI 2020-07-15 /pmc/articles/PMC7407952/ /pubmed/32679738 http://dx.doi.org/10.3390/biom10071048 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Lee, Kippeum
Jin, Heegu
Chei, Sungwoo
Oh, Hyun-Ji
Choi, Sun-Hye
Nah, Seung-Yeol
Lee, Boo-Yong
The Gintonin-Enriched Fraction of Ginseng Regulates Lipid Metabolism and Browning via the cAMP-Protein Kinase a Signaling Pathway in Mice White Adipocytes
title The Gintonin-Enriched Fraction of Ginseng Regulates Lipid Metabolism and Browning via the cAMP-Protein Kinase a Signaling Pathway in Mice White Adipocytes
title_full The Gintonin-Enriched Fraction of Ginseng Regulates Lipid Metabolism and Browning via the cAMP-Protein Kinase a Signaling Pathway in Mice White Adipocytes
title_fullStr The Gintonin-Enriched Fraction of Ginseng Regulates Lipid Metabolism and Browning via the cAMP-Protein Kinase a Signaling Pathway in Mice White Adipocytes
title_full_unstemmed The Gintonin-Enriched Fraction of Ginseng Regulates Lipid Metabolism and Browning via the cAMP-Protein Kinase a Signaling Pathway in Mice White Adipocytes
title_short The Gintonin-Enriched Fraction of Ginseng Regulates Lipid Metabolism and Browning via the cAMP-Protein Kinase a Signaling Pathway in Mice White Adipocytes
title_sort gintonin-enriched fraction of ginseng regulates lipid metabolism and browning via the camp-protein kinase a signaling pathway in mice white adipocytes
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7407952/
https://www.ncbi.nlm.nih.gov/pubmed/32679738
http://dx.doi.org/10.3390/biom10071048
work_keys_str_mv AT leekippeum thegintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes
AT jinheegu thegintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes
AT cheisungwoo thegintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes
AT ohhyunji thegintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes
AT choisunhye thegintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes
AT nahseungyeol thegintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes
AT leebooyong thegintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes
AT leekippeum gintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes
AT jinheegu gintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes
AT cheisungwoo gintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes
AT ohhyunji gintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes
AT choisunhye gintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes
AT nahseungyeol gintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes
AT leebooyong gintoninenrichedfractionofginsengregulateslipidmetabolismandbrowningviathecampproteinkinaseasignalingpathwayinmicewhiteadipocytes