Cargando…

MicroRNA-126 Modulates Palmitate-Induced Migration in HUVECs by Downregulating Myosin Light Chain Kinase via the ERK/MAPK Pathway

MicroRNA-126 (miR-126) is an endothelial-specific microRNA that has shown beneficial effects on endothelial dysfunction. However, the underlying molecular mechanism is unclear. The present study evaluated the effects of miR-126 on the cell migration and underlying mechanism in HUVECs treated with pa...

Descripción completa

Detalles Bibliográficos
Autores principales: Wang, Yi, Wang, Mei, Yu, Pei, Zuo, Li, Zhou, Qing, Zhou, Xiaomei, Zhu, Huaqing
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7411007/
https://www.ncbi.nlm.nih.gov/pubmed/32850751
http://dx.doi.org/10.3389/fbioe.2020.00913
_version_ 1783568286351360000
author Wang, Yi
Wang, Mei
Yu, Pei
Zuo, Li
Zhou, Qing
Zhou, Xiaomei
Zhu, Huaqing
author_facet Wang, Yi
Wang, Mei
Yu, Pei
Zuo, Li
Zhou, Qing
Zhou, Xiaomei
Zhu, Huaqing
author_sort Wang, Yi
collection PubMed
description MicroRNA-126 (miR-126) is an endothelial-specific microRNA that has shown beneficial effects on endothelial dysfunction. However, the underlying molecular mechanism is unclear. The present study evaluated the effects of miR-126 on the cell migration and underlying mechanism in HUVECs treated with palmitate. The present results demonstrated that overexpression of miR-126 was found to decrease cell migration in palmitate-treated HUVECs, with decreased MLCK expression and subsequent decreased phosphorylated MLC level. miR-126 also decreased the phosphorylation of MYPT1 in palmitate-treated HUVECs. In addition, it was demonstrated that miR-126 decreases expression of the NADPH oxidase subunits, p67 and Rac family small GTPase 1 with a subsequent decrease in cell apoptosis. Moreover, the phosphorylation of ERK was reduced by miR-126 in palmitate-induced HUVECs. Taken together, the present study showed that the effect of miR-126 on cell migration and cell apoptosis is mediated through downregulation of MLCK via the ERK/MAPK pathway.
format Online
Article
Text
id pubmed-7411007
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-74110072020-08-25 MicroRNA-126 Modulates Palmitate-Induced Migration in HUVECs by Downregulating Myosin Light Chain Kinase via the ERK/MAPK Pathway Wang, Yi Wang, Mei Yu, Pei Zuo, Li Zhou, Qing Zhou, Xiaomei Zhu, Huaqing Front Bioeng Biotechnol Bioengineering and Biotechnology MicroRNA-126 (miR-126) is an endothelial-specific microRNA that has shown beneficial effects on endothelial dysfunction. However, the underlying molecular mechanism is unclear. The present study evaluated the effects of miR-126 on the cell migration and underlying mechanism in HUVECs treated with palmitate. The present results demonstrated that overexpression of miR-126 was found to decrease cell migration in palmitate-treated HUVECs, with decreased MLCK expression and subsequent decreased phosphorylated MLC level. miR-126 also decreased the phosphorylation of MYPT1 in palmitate-treated HUVECs. In addition, it was demonstrated that miR-126 decreases expression of the NADPH oxidase subunits, p67 and Rac family small GTPase 1 with a subsequent decrease in cell apoptosis. Moreover, the phosphorylation of ERK was reduced by miR-126 in palmitate-induced HUVECs. Taken together, the present study showed that the effect of miR-126 on cell migration and cell apoptosis is mediated through downregulation of MLCK via the ERK/MAPK pathway. Frontiers Media S.A. 2020-07-31 /pmc/articles/PMC7411007/ /pubmed/32850751 http://dx.doi.org/10.3389/fbioe.2020.00913 Text en Copyright © 2020 Wang, Wang, Yu, Zuo, Zhou, Zhou and Zhu. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Bioengineering and Biotechnology
Wang, Yi
Wang, Mei
Yu, Pei
Zuo, Li
Zhou, Qing
Zhou, Xiaomei
Zhu, Huaqing
MicroRNA-126 Modulates Palmitate-Induced Migration in HUVECs by Downregulating Myosin Light Chain Kinase via the ERK/MAPK Pathway
title MicroRNA-126 Modulates Palmitate-Induced Migration in HUVECs by Downregulating Myosin Light Chain Kinase via the ERK/MAPK Pathway
title_full MicroRNA-126 Modulates Palmitate-Induced Migration in HUVECs by Downregulating Myosin Light Chain Kinase via the ERK/MAPK Pathway
title_fullStr MicroRNA-126 Modulates Palmitate-Induced Migration in HUVECs by Downregulating Myosin Light Chain Kinase via the ERK/MAPK Pathway
title_full_unstemmed MicroRNA-126 Modulates Palmitate-Induced Migration in HUVECs by Downregulating Myosin Light Chain Kinase via the ERK/MAPK Pathway
title_short MicroRNA-126 Modulates Palmitate-Induced Migration in HUVECs by Downregulating Myosin Light Chain Kinase via the ERK/MAPK Pathway
title_sort microrna-126 modulates palmitate-induced migration in huvecs by downregulating myosin light chain kinase via the erk/mapk pathway
topic Bioengineering and Biotechnology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7411007/
https://www.ncbi.nlm.nih.gov/pubmed/32850751
http://dx.doi.org/10.3389/fbioe.2020.00913
work_keys_str_mv AT wangyi microrna126modulatespalmitateinducedmigrationinhuvecsbydownregulatingmyosinlightchainkinaseviatheerkmapkpathway
AT wangmei microrna126modulatespalmitateinducedmigrationinhuvecsbydownregulatingmyosinlightchainkinaseviatheerkmapkpathway
AT yupei microrna126modulatespalmitateinducedmigrationinhuvecsbydownregulatingmyosinlightchainkinaseviatheerkmapkpathway
AT zuoli microrna126modulatespalmitateinducedmigrationinhuvecsbydownregulatingmyosinlightchainkinaseviatheerkmapkpathway
AT zhouqing microrna126modulatespalmitateinducedmigrationinhuvecsbydownregulatingmyosinlightchainkinaseviatheerkmapkpathway
AT zhouxiaomei microrna126modulatespalmitateinducedmigrationinhuvecsbydownregulatingmyosinlightchainkinaseviatheerkmapkpathway
AT zhuhuaqing microrna126modulatespalmitateinducedmigrationinhuvecsbydownregulatingmyosinlightchainkinaseviatheerkmapkpathway