Cargando…
MicroRNA-126 Modulates Palmitate-Induced Migration in HUVECs by Downregulating Myosin Light Chain Kinase via the ERK/MAPK Pathway
MicroRNA-126 (miR-126) is an endothelial-specific microRNA that has shown beneficial effects on endothelial dysfunction. However, the underlying molecular mechanism is unclear. The present study evaluated the effects of miR-126 on the cell migration and underlying mechanism in HUVECs treated with pa...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7411007/ https://www.ncbi.nlm.nih.gov/pubmed/32850751 http://dx.doi.org/10.3389/fbioe.2020.00913 |
_version_ | 1783568286351360000 |
---|---|
author | Wang, Yi Wang, Mei Yu, Pei Zuo, Li Zhou, Qing Zhou, Xiaomei Zhu, Huaqing |
author_facet | Wang, Yi Wang, Mei Yu, Pei Zuo, Li Zhou, Qing Zhou, Xiaomei Zhu, Huaqing |
author_sort | Wang, Yi |
collection | PubMed |
description | MicroRNA-126 (miR-126) is an endothelial-specific microRNA that has shown beneficial effects on endothelial dysfunction. However, the underlying molecular mechanism is unclear. The present study evaluated the effects of miR-126 on the cell migration and underlying mechanism in HUVECs treated with palmitate. The present results demonstrated that overexpression of miR-126 was found to decrease cell migration in palmitate-treated HUVECs, with decreased MLCK expression and subsequent decreased phosphorylated MLC level. miR-126 also decreased the phosphorylation of MYPT1 in palmitate-treated HUVECs. In addition, it was demonstrated that miR-126 decreases expression of the NADPH oxidase subunits, p67 and Rac family small GTPase 1 with a subsequent decrease in cell apoptosis. Moreover, the phosphorylation of ERK was reduced by miR-126 in palmitate-induced HUVECs. Taken together, the present study showed that the effect of miR-126 on cell migration and cell apoptosis is mediated through downregulation of MLCK via the ERK/MAPK pathway. |
format | Online Article Text |
id | pubmed-7411007 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-74110072020-08-25 MicroRNA-126 Modulates Palmitate-Induced Migration in HUVECs by Downregulating Myosin Light Chain Kinase via the ERK/MAPK Pathway Wang, Yi Wang, Mei Yu, Pei Zuo, Li Zhou, Qing Zhou, Xiaomei Zhu, Huaqing Front Bioeng Biotechnol Bioengineering and Biotechnology MicroRNA-126 (miR-126) is an endothelial-specific microRNA that has shown beneficial effects on endothelial dysfunction. However, the underlying molecular mechanism is unclear. The present study evaluated the effects of miR-126 on the cell migration and underlying mechanism in HUVECs treated with palmitate. The present results demonstrated that overexpression of miR-126 was found to decrease cell migration in palmitate-treated HUVECs, with decreased MLCK expression and subsequent decreased phosphorylated MLC level. miR-126 also decreased the phosphorylation of MYPT1 in palmitate-treated HUVECs. In addition, it was demonstrated that miR-126 decreases expression of the NADPH oxidase subunits, p67 and Rac family small GTPase 1 with a subsequent decrease in cell apoptosis. Moreover, the phosphorylation of ERK was reduced by miR-126 in palmitate-induced HUVECs. Taken together, the present study showed that the effect of miR-126 on cell migration and cell apoptosis is mediated through downregulation of MLCK via the ERK/MAPK pathway. Frontiers Media S.A. 2020-07-31 /pmc/articles/PMC7411007/ /pubmed/32850751 http://dx.doi.org/10.3389/fbioe.2020.00913 Text en Copyright © 2020 Wang, Wang, Yu, Zuo, Zhou, Zhou and Zhu. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Bioengineering and Biotechnology Wang, Yi Wang, Mei Yu, Pei Zuo, Li Zhou, Qing Zhou, Xiaomei Zhu, Huaqing MicroRNA-126 Modulates Palmitate-Induced Migration in HUVECs by Downregulating Myosin Light Chain Kinase via the ERK/MAPK Pathway |
title | MicroRNA-126 Modulates Palmitate-Induced Migration in HUVECs by Downregulating Myosin Light Chain Kinase via the ERK/MAPK Pathway |
title_full | MicroRNA-126 Modulates Palmitate-Induced Migration in HUVECs by Downregulating Myosin Light Chain Kinase via the ERK/MAPK Pathway |
title_fullStr | MicroRNA-126 Modulates Palmitate-Induced Migration in HUVECs by Downregulating Myosin Light Chain Kinase via the ERK/MAPK Pathway |
title_full_unstemmed | MicroRNA-126 Modulates Palmitate-Induced Migration in HUVECs by Downregulating Myosin Light Chain Kinase via the ERK/MAPK Pathway |
title_short | MicroRNA-126 Modulates Palmitate-Induced Migration in HUVECs by Downregulating Myosin Light Chain Kinase via the ERK/MAPK Pathway |
title_sort | microrna-126 modulates palmitate-induced migration in huvecs by downregulating myosin light chain kinase via the erk/mapk pathway |
topic | Bioengineering and Biotechnology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7411007/ https://www.ncbi.nlm.nih.gov/pubmed/32850751 http://dx.doi.org/10.3389/fbioe.2020.00913 |
work_keys_str_mv | AT wangyi microrna126modulatespalmitateinducedmigrationinhuvecsbydownregulatingmyosinlightchainkinaseviatheerkmapkpathway AT wangmei microrna126modulatespalmitateinducedmigrationinhuvecsbydownregulatingmyosinlightchainkinaseviatheerkmapkpathway AT yupei microrna126modulatespalmitateinducedmigrationinhuvecsbydownregulatingmyosinlightchainkinaseviatheerkmapkpathway AT zuoli microrna126modulatespalmitateinducedmigrationinhuvecsbydownregulatingmyosinlightchainkinaseviatheerkmapkpathway AT zhouqing microrna126modulatespalmitateinducedmigrationinhuvecsbydownregulatingmyosinlightchainkinaseviatheerkmapkpathway AT zhouxiaomei microrna126modulatespalmitateinducedmigrationinhuvecsbydownregulatingmyosinlightchainkinaseviatheerkmapkpathway AT zhuhuaqing microrna126modulatespalmitateinducedmigrationinhuvecsbydownregulatingmyosinlightchainkinaseviatheerkmapkpathway |