Cargando…

Impact of physical activity and exercise on bone health in patients with chronic kidney disease: a systematic review of observational and experimental studies

BACKGROUND: Chronic Kidney Disease (CKD) patients frequently develop life-impairing bone mineral disorders. Despite the reported impact of exercise on bone health, systematic reviews of the evidence are lacking. This review examines the association of both physical activity (PA) and the effects of d...

Descripción completa

Detalles Bibliográficos
Autores principales: Cardoso, Daniela F., Marques, Elisa A., Leal, Diogo V., Ferreira, Aníbal, Baker, Luke A., Smith, Alice C., Viana, João L.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7414574/
https://www.ncbi.nlm.nih.gov/pubmed/32770949
http://dx.doi.org/10.1186/s12882-020-01999-z
_version_ 1783568995184541696
author Cardoso, Daniela F.
Marques, Elisa A.
Leal, Diogo V.
Ferreira, Aníbal
Baker, Luke A.
Smith, Alice C.
Viana, João L.
author_facet Cardoso, Daniela F.
Marques, Elisa A.
Leal, Diogo V.
Ferreira, Aníbal
Baker, Luke A.
Smith, Alice C.
Viana, João L.
author_sort Cardoso, Daniela F.
collection PubMed
description BACKGROUND: Chronic Kidney Disease (CKD) patients frequently develop life-impairing bone mineral disorders. Despite the reported impact of exercise on bone health, systematic reviews of the evidence are lacking. This review examines the association of both physical activity (PA) and the effects of different exercise interventions with bone outcomes in CKD. METHODS: English-language publications in EBSCO, Web of Science and Scopus were searched up to May 2019, from which observational and experimental studies examining the relation between PA and the effect of regular exercise on bone-imaging or -outcomes in CKD stage 3–5 adults were included. All data were extracted and recorded using a spreadsheet by two review authors. The evidence quality was rated using the Cochrane risk of bias tool and a modified Newcastle-Ottawa scale. RESULTS: Six observational (4 cross-sectional, 2 longitudinal) and seven experimental (2 aerobic-, 5 resistance-exercise trials) studies were included, with an overall sample size of 367 and 215 patients, respectively. Judged risk of bias was low and unclear in most observational and experimental studies, respectively. PA was positively associated with bone mineral density at lumbar spine, femoral neck and total body, but not with bone biomarkers. Resistance exercise seems to improve bone mass at femoral neck and proximal femur, with improved bone formation and inhibited bone resorption observed, despite the inconsistency of results amongst different studies. CONCLUSIONS: There is partial evidence supporting (i) a positive relation of PA and bone outcomes, and (ii) positive effects of resistance exercise on bone health in CKD. Prospective population studies and long-term RCT trials exploring different exercise modalities measuring bone-related parameters as endpoint are currently lacking.
format Online
Article
Text
id pubmed-7414574
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-74145742020-08-10 Impact of physical activity and exercise on bone health in patients with chronic kidney disease: a systematic review of observational and experimental studies Cardoso, Daniela F. Marques, Elisa A. Leal, Diogo V. Ferreira, Aníbal Baker, Luke A. Smith, Alice C. Viana, João L. BMC Nephrol Research Article BACKGROUND: Chronic Kidney Disease (CKD) patients frequently develop life-impairing bone mineral disorders. Despite the reported impact of exercise on bone health, systematic reviews of the evidence are lacking. This review examines the association of both physical activity (PA) and the effects of different exercise interventions with bone outcomes in CKD. METHODS: English-language publications in EBSCO, Web of Science and Scopus were searched up to May 2019, from which observational and experimental studies examining the relation between PA and the effect of regular exercise on bone-imaging or -outcomes in CKD stage 3–5 adults were included. All data were extracted and recorded using a spreadsheet by two review authors. The evidence quality was rated using the Cochrane risk of bias tool and a modified Newcastle-Ottawa scale. RESULTS: Six observational (4 cross-sectional, 2 longitudinal) and seven experimental (2 aerobic-, 5 resistance-exercise trials) studies were included, with an overall sample size of 367 and 215 patients, respectively. Judged risk of bias was low and unclear in most observational and experimental studies, respectively. PA was positively associated with bone mineral density at lumbar spine, femoral neck and total body, but not with bone biomarkers. Resistance exercise seems to improve bone mass at femoral neck and proximal femur, with improved bone formation and inhibited bone resorption observed, despite the inconsistency of results amongst different studies. CONCLUSIONS: There is partial evidence supporting (i) a positive relation of PA and bone outcomes, and (ii) positive effects of resistance exercise on bone health in CKD. Prospective population studies and long-term RCT trials exploring different exercise modalities measuring bone-related parameters as endpoint are currently lacking. BioMed Central 2020-08-08 /pmc/articles/PMC7414574/ /pubmed/32770949 http://dx.doi.org/10.1186/s12882-020-01999-z Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
Cardoso, Daniela F.
Marques, Elisa A.
Leal, Diogo V.
Ferreira, Aníbal
Baker, Luke A.
Smith, Alice C.
Viana, João L.
Impact of physical activity and exercise on bone health in patients with chronic kidney disease: a systematic review of observational and experimental studies
title Impact of physical activity and exercise on bone health in patients with chronic kidney disease: a systematic review of observational and experimental studies
title_full Impact of physical activity and exercise on bone health in patients with chronic kidney disease: a systematic review of observational and experimental studies
title_fullStr Impact of physical activity and exercise on bone health in patients with chronic kidney disease: a systematic review of observational and experimental studies
title_full_unstemmed Impact of physical activity and exercise on bone health in patients with chronic kidney disease: a systematic review of observational and experimental studies
title_short Impact of physical activity and exercise on bone health in patients with chronic kidney disease: a systematic review of observational and experimental studies
title_sort impact of physical activity and exercise on bone health in patients with chronic kidney disease: a systematic review of observational and experimental studies
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7414574/
https://www.ncbi.nlm.nih.gov/pubmed/32770949
http://dx.doi.org/10.1186/s12882-020-01999-z
work_keys_str_mv AT cardosodanielaf impactofphysicalactivityandexerciseonbonehealthinpatientswithchronickidneydiseaseasystematicreviewofobservationalandexperimentalstudies
AT marqueselisaa impactofphysicalactivityandexerciseonbonehealthinpatientswithchronickidneydiseaseasystematicreviewofobservationalandexperimentalstudies
AT lealdiogov impactofphysicalactivityandexerciseonbonehealthinpatientswithchronickidneydiseaseasystematicreviewofobservationalandexperimentalstudies
AT ferreiraanibal impactofphysicalactivityandexerciseonbonehealthinpatientswithchronickidneydiseaseasystematicreviewofobservationalandexperimentalstudies
AT bakerlukea impactofphysicalactivityandexerciseonbonehealthinpatientswithchronickidneydiseaseasystematicreviewofobservationalandexperimentalstudies
AT smithalicec impactofphysicalactivityandexerciseonbonehealthinpatientswithchronickidneydiseaseasystematicreviewofobservationalandexperimentalstudies
AT vianajoaol impactofphysicalactivityandexerciseonbonehealthinpatientswithchronickidneydiseaseasystematicreviewofobservationalandexperimentalstudies