Cargando…

The cacao procyanidin extract-caused anti-hyperglycemic effect was changed by the administration timings

Mammals have the biological clocks with approximately 24 h-rhythm. Energy metabolism including glucose metabolism is regulated by the biological clocks. Glucose metabolism is affected by not only meal volume and its energy but also meal timing. We have reported that cacao liquor procyanidin-rich ext...

Descripción completa

Detalles Bibliográficos
Autores principales: Hironao, Ken-yu, Ashida, Hitoshi, Yamashita, Yoko
Formato: Online Artículo Texto
Lenguaje:English
Publicado: the Society for Free Radical Research Japan 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7417804/
https://www.ncbi.nlm.nih.gov/pubmed/32801470
http://dx.doi.org/10.3164/jcbn.20-45
_version_ 1783569571600400384
author Hironao, Ken-yu
Ashida, Hitoshi
Yamashita, Yoko
author_facet Hironao, Ken-yu
Ashida, Hitoshi
Yamashita, Yoko
author_sort Hironao, Ken-yu
collection PubMed
description Mammals have the biological clocks with approximately 24 h-rhythm. Energy metabolism including glucose metabolism is regulated by the biological clocks. Glucose metabolism is affected by not only meal volume and its energy but also meal timing. We have reported that cacao liquor procyanidin-rich extract (CLPr) ameliorated the postprandial hyperglycemia through AMP-activated protein kinase pathway. However, the effect of administration timing of CLPr on the postprandial hyperglycemia and its signaling pathway are still unclear. In the present study, we compared the effect of CLPr-administration at the rest-phase (light-period) and active-phase (dark-period) on glucose metabolism. Single oral administration of CLPr to ICR mice at the rest-phase, but not at the active-phase, promoted phosphorylation of AMP-activated protein kinase and its upstream liver kinase B1 and translocation of glucose transporter 4 to the plasma membrane in the skeletal muscle, resulting in reduced postprandial hyperglycemia. These results indicated that the intake of CLPr at the rest-phase more effectively suppressed postprandial hyperglycemia.
format Online
Article
Text
id pubmed-7417804
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher the Society for Free Radical Research Japan
record_format MEDLINE/PubMed
spelling pubmed-74178042020-08-13 The cacao procyanidin extract-caused anti-hyperglycemic effect was changed by the administration timings Hironao, Ken-yu Ashida, Hitoshi Yamashita, Yoko J Clin Biochem Nutr Original Article Mammals have the biological clocks with approximately 24 h-rhythm. Energy metabolism including glucose metabolism is regulated by the biological clocks. Glucose metabolism is affected by not only meal volume and its energy but also meal timing. We have reported that cacao liquor procyanidin-rich extract (CLPr) ameliorated the postprandial hyperglycemia through AMP-activated protein kinase pathway. However, the effect of administration timing of CLPr on the postprandial hyperglycemia and its signaling pathway are still unclear. In the present study, we compared the effect of CLPr-administration at the rest-phase (light-period) and active-phase (dark-period) on glucose metabolism. Single oral administration of CLPr to ICR mice at the rest-phase, but not at the active-phase, promoted phosphorylation of AMP-activated protein kinase and its upstream liver kinase B1 and translocation of glucose transporter 4 to the plasma membrane in the skeletal muscle, resulting in reduced postprandial hyperglycemia. These results indicated that the intake of CLPr at the rest-phase more effectively suppressed postprandial hyperglycemia. the Society for Free Radical Research Japan 2020-07 2020-06-05 /pmc/articles/PMC7417804/ /pubmed/32801470 http://dx.doi.org/10.3164/jcbn.20-45 Text en Copyright © 2020 JCBN http://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Original Article
Hironao, Ken-yu
Ashida, Hitoshi
Yamashita, Yoko
The cacao procyanidin extract-caused anti-hyperglycemic effect was changed by the administration timings
title The cacao procyanidin extract-caused anti-hyperglycemic effect was changed by the administration timings
title_full The cacao procyanidin extract-caused anti-hyperglycemic effect was changed by the administration timings
title_fullStr The cacao procyanidin extract-caused anti-hyperglycemic effect was changed by the administration timings
title_full_unstemmed The cacao procyanidin extract-caused anti-hyperglycemic effect was changed by the administration timings
title_short The cacao procyanidin extract-caused anti-hyperglycemic effect was changed by the administration timings
title_sort cacao procyanidin extract-caused anti-hyperglycemic effect was changed by the administration timings
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7417804/
https://www.ncbi.nlm.nih.gov/pubmed/32801470
http://dx.doi.org/10.3164/jcbn.20-45
work_keys_str_mv AT hironaokenyu thecacaoprocyanidinextractcausedantihyperglycemiceffectwaschangedbytheadministrationtimings
AT ashidahitoshi thecacaoprocyanidinextractcausedantihyperglycemiceffectwaschangedbytheadministrationtimings
AT yamashitayoko thecacaoprocyanidinextractcausedantihyperglycemiceffectwaschangedbytheadministrationtimings
AT hironaokenyu cacaoprocyanidinextractcausedantihyperglycemiceffectwaschangedbytheadministrationtimings
AT ashidahitoshi cacaoprocyanidinextractcausedantihyperglycemiceffectwaschangedbytheadministrationtimings
AT yamashitayoko cacaoprocyanidinextractcausedantihyperglycemiceffectwaschangedbytheadministrationtimings