Cargando…

Early childhood education and care-based healthy eating interventions for improving child diet: a systematic review protocol

INTRODUCTION: Diet during infancy and early childhood can have implications on child growth, health, and developmental trajectories. Yet, poor dietary habits are common in young children, who often consume diets that are not aligned with dietary recommendations. Early childhood education and care (E...

Descripción completa

Detalles Bibliográficos
Autores principales: Jackson, Jacklyn, Wolfenden, Luke, Grady, Alice, Lum, Melanie, Leonard, Alecia, McCrabb, Sam, Hall, Alix, Pearson, Nicole, Barnes, Courtney, Yoong, Sze Lin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7425066/
https://www.ncbi.nlm.nih.gov/pubmed/32792009
http://dx.doi.org/10.1186/s13643-020-01440-4
_version_ 1783570424188108800
author Jackson, Jacklyn
Wolfenden, Luke
Grady, Alice
Lum, Melanie
Leonard, Alecia
McCrabb, Sam
Hall, Alix
Pearson, Nicole
Barnes, Courtney
Yoong, Sze Lin
author_facet Jackson, Jacklyn
Wolfenden, Luke
Grady, Alice
Lum, Melanie
Leonard, Alecia
McCrabb, Sam
Hall, Alix
Pearson, Nicole
Barnes, Courtney
Yoong, Sze Lin
author_sort Jackson, Jacklyn
collection PubMed
description INTRODUCTION: Diet during infancy and early childhood can have implications on child growth, health, and developmental trajectories. Yet, poor dietary habits are common in young children, who often consume diets that are not aligned with dietary recommendations. Early childhood education and care (ECEC) is a recommended setting to deliver healthy eating interventions as they offer existing infrastructure and access to a large number of children. This protocol aims to describe the methods of a systematic review to assess the effectiveness of healthy eating interventions conducted within the ECEC setting to improve child diet. METHODS AND ANALYSIS: Eight electronic databases including Cochrane Central Register of Controlled Trials (CENTRAL), Ovid MEDLINE, EMBASE, CINAHL Complete, PsycINFO, ERIC, SCOPUS, and SPORTDiscus will be searched from conception to March 2020. Randomised controlled trials (RCT) of dietary interventions targeting children aged up to 6 years conducted within the ECEC setting (including pre-schools, kindergartens, long day care, and family day care) will be included in the review. The primary review outcome is any measure of child dietary intake. Secondary outcomes include (i) child anthropometrics, (ii) child cognition, (iii) child mental health, (iv) child quality of life, (v) the absolute cost or cost-effectiveness of included interventions, and (vi) any reported adverse effects. Study inclusion, data extraction, and risk of bias assessments will be performed independently by two reviewers. Meta-analyses will be performed if adequate data is available, else review findings will be described narratively. DISCUSSION: This systematic review seeks to synthesise the effectiveness of healthy eating interventions conducted within the ECEC setting for improving child diet. This review will also seek to describe the effect of ECEC-based healthy eating interventions on a variety of important secondary outcomes (adverse events and cost-effectiveness) that will enhance the public health policy and practice relevance of review findings. SYSTEMATIC REVIEW REGISTRATION: PROSPERO [ID CRD42020153188]
format Online
Article
Text
id pubmed-7425066
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-74250662020-08-16 Early childhood education and care-based healthy eating interventions for improving child diet: a systematic review protocol Jackson, Jacklyn Wolfenden, Luke Grady, Alice Lum, Melanie Leonard, Alecia McCrabb, Sam Hall, Alix Pearson, Nicole Barnes, Courtney Yoong, Sze Lin Syst Rev Protocol INTRODUCTION: Diet during infancy and early childhood can have implications on child growth, health, and developmental trajectories. Yet, poor dietary habits are common in young children, who often consume diets that are not aligned with dietary recommendations. Early childhood education and care (ECEC) is a recommended setting to deliver healthy eating interventions as they offer existing infrastructure and access to a large number of children. This protocol aims to describe the methods of a systematic review to assess the effectiveness of healthy eating interventions conducted within the ECEC setting to improve child diet. METHODS AND ANALYSIS: Eight electronic databases including Cochrane Central Register of Controlled Trials (CENTRAL), Ovid MEDLINE, EMBASE, CINAHL Complete, PsycINFO, ERIC, SCOPUS, and SPORTDiscus will be searched from conception to March 2020. Randomised controlled trials (RCT) of dietary interventions targeting children aged up to 6 years conducted within the ECEC setting (including pre-schools, kindergartens, long day care, and family day care) will be included in the review. The primary review outcome is any measure of child dietary intake. Secondary outcomes include (i) child anthropometrics, (ii) child cognition, (iii) child mental health, (iv) child quality of life, (v) the absolute cost or cost-effectiveness of included interventions, and (vi) any reported adverse effects. Study inclusion, data extraction, and risk of bias assessments will be performed independently by two reviewers. Meta-analyses will be performed if adequate data is available, else review findings will be described narratively. DISCUSSION: This systematic review seeks to synthesise the effectiveness of healthy eating interventions conducted within the ECEC setting for improving child diet. This review will also seek to describe the effect of ECEC-based healthy eating interventions on a variety of important secondary outcomes (adverse events and cost-effectiveness) that will enhance the public health policy and practice relevance of review findings. SYSTEMATIC REVIEW REGISTRATION: PROSPERO [ID CRD42020153188] BioMed Central 2020-08-13 /pmc/articles/PMC7425066/ /pubmed/32792009 http://dx.doi.org/10.1186/s13643-020-01440-4 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Protocol
Jackson, Jacklyn
Wolfenden, Luke
Grady, Alice
Lum, Melanie
Leonard, Alecia
McCrabb, Sam
Hall, Alix
Pearson, Nicole
Barnes, Courtney
Yoong, Sze Lin
Early childhood education and care-based healthy eating interventions for improving child diet: a systematic review protocol
title Early childhood education and care-based healthy eating interventions for improving child diet: a systematic review protocol
title_full Early childhood education and care-based healthy eating interventions for improving child diet: a systematic review protocol
title_fullStr Early childhood education and care-based healthy eating interventions for improving child diet: a systematic review protocol
title_full_unstemmed Early childhood education and care-based healthy eating interventions for improving child diet: a systematic review protocol
title_short Early childhood education and care-based healthy eating interventions for improving child diet: a systematic review protocol
title_sort early childhood education and care-based healthy eating interventions for improving child diet: a systematic review protocol
topic Protocol
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7425066/
https://www.ncbi.nlm.nih.gov/pubmed/32792009
http://dx.doi.org/10.1186/s13643-020-01440-4
work_keys_str_mv AT jacksonjacklyn earlychildhoodeducationandcarebasedhealthyeatinginterventionsforimprovingchilddietasystematicreviewprotocol
AT wolfendenluke earlychildhoodeducationandcarebasedhealthyeatinginterventionsforimprovingchilddietasystematicreviewprotocol
AT gradyalice earlychildhoodeducationandcarebasedhealthyeatinginterventionsforimprovingchilddietasystematicreviewprotocol
AT lummelanie earlychildhoodeducationandcarebasedhealthyeatinginterventionsforimprovingchilddietasystematicreviewprotocol
AT leonardalecia earlychildhoodeducationandcarebasedhealthyeatinginterventionsforimprovingchilddietasystematicreviewprotocol
AT mccrabbsam earlychildhoodeducationandcarebasedhealthyeatinginterventionsforimprovingchilddietasystematicreviewprotocol
AT hallalix earlychildhoodeducationandcarebasedhealthyeatinginterventionsforimprovingchilddietasystematicreviewprotocol
AT pearsonnicole earlychildhoodeducationandcarebasedhealthyeatinginterventionsforimprovingchilddietasystematicreviewprotocol
AT barnescourtney earlychildhoodeducationandcarebasedhealthyeatinginterventionsforimprovingchilddietasystematicreviewprotocol
AT yoongszelin earlychildhoodeducationandcarebasedhealthyeatinginterventionsforimprovingchilddietasystematicreviewprotocol