Cargando…
Patient and health system costs of managing pregnancy and birth-related complications in sub-Saharan Africa: a systematic review
BACKGROUND: Morbidity and mortality due to pregnancy and childbearing are high in developing countries. This study aims to estimate patient and health system costs of managing pregnancy and birth-related complications in sub-Saharan Africa. METHODS: A systematic review of the literature was conducte...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer Berlin Heidelberg
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7429732/ https://www.ncbi.nlm.nih.gov/pubmed/32803373 http://dx.doi.org/10.1186/s13561-020-00283-y |
_version_ | 1783571307060789248 |
---|---|
author | Mori, Amani Thomas Binyaruka, Peter Hangoma, Peter Robberstad, Bjarne Sandoy, Ingvild |
author_facet | Mori, Amani Thomas Binyaruka, Peter Hangoma, Peter Robberstad, Bjarne Sandoy, Ingvild |
author_sort | Mori, Amani Thomas |
collection | PubMed |
description | BACKGROUND: Morbidity and mortality due to pregnancy and childbearing are high in developing countries. This study aims to estimate patient and health system costs of managing pregnancy and birth-related complications in sub-Saharan Africa. METHODS: A systematic review of the literature was conducted to identify costing studies published and unpublished, from January 2000 to May 2019. The search was done in Pubmed, EMBASE, Cinahl, and Web of Science databases and grey literature. The study was registered in PROSPERO with registration No. CRD42019119316. All costs were converted to 2018 US dollars using relevant Consumer Price Indices. RESULTS: Out of 1652 studies identified, 48 fulfilled the inclusion criteria. The included studies were of moderate to high quality. Spontaneous vaginal delivery cost patients and health systems between USD 6–52 and USD 8–73, but cesarean section costs between USD 56–377 and USD 80–562, respectively. Patient and health system costs of abortion range between USD 11–66 and USD 40–298, while post-abortion care costs between USD 21–158 and USD 46–151, respectively. The patient and health system costs for managing a case of eclampsia range between USD 52–231 and USD 123–186, while for maternal hemorrhage they range between USD 65–196 and USD 30–127, respectively. Patient cost for caring low-birth weight babies ranges between USD 38–489 while the health system cost was estimated to be USD 514. CONCLUSION: This is the first systematic review to compile comprehensive up-to-date patient and health system costs of managing pregnancy and birth-related complications in sub-Saharan Africa. It indicates that these costs are relatively high in this region and that patient costs were largely catastrophic relative to a 10 % of average national per capita income. |
format | Online Article Text |
id | pubmed-7429732 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Springer Berlin Heidelberg |
record_format | MEDLINE/PubMed |
spelling | pubmed-74297322020-08-18 Patient and health system costs of managing pregnancy and birth-related complications in sub-Saharan Africa: a systematic review Mori, Amani Thomas Binyaruka, Peter Hangoma, Peter Robberstad, Bjarne Sandoy, Ingvild Health Econ Rev Review BACKGROUND: Morbidity and mortality due to pregnancy and childbearing are high in developing countries. This study aims to estimate patient and health system costs of managing pregnancy and birth-related complications in sub-Saharan Africa. METHODS: A systematic review of the literature was conducted to identify costing studies published and unpublished, from January 2000 to May 2019. The search was done in Pubmed, EMBASE, Cinahl, and Web of Science databases and grey literature. The study was registered in PROSPERO with registration No. CRD42019119316. All costs were converted to 2018 US dollars using relevant Consumer Price Indices. RESULTS: Out of 1652 studies identified, 48 fulfilled the inclusion criteria. The included studies were of moderate to high quality. Spontaneous vaginal delivery cost patients and health systems between USD 6–52 and USD 8–73, but cesarean section costs between USD 56–377 and USD 80–562, respectively. Patient and health system costs of abortion range between USD 11–66 and USD 40–298, while post-abortion care costs between USD 21–158 and USD 46–151, respectively. The patient and health system costs for managing a case of eclampsia range between USD 52–231 and USD 123–186, while for maternal hemorrhage they range between USD 65–196 and USD 30–127, respectively. Patient cost for caring low-birth weight babies ranges between USD 38–489 while the health system cost was estimated to be USD 514. CONCLUSION: This is the first systematic review to compile comprehensive up-to-date patient and health system costs of managing pregnancy and birth-related complications in sub-Saharan Africa. It indicates that these costs are relatively high in this region and that patient costs were largely catastrophic relative to a 10 % of average national per capita income. Springer Berlin Heidelberg 2020-08-15 /pmc/articles/PMC7429732/ /pubmed/32803373 http://dx.doi.org/10.1186/s13561-020-00283-y Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Review Mori, Amani Thomas Binyaruka, Peter Hangoma, Peter Robberstad, Bjarne Sandoy, Ingvild Patient and health system costs of managing pregnancy and birth-related complications in sub-Saharan Africa: a systematic review |
title | Patient and health system costs of managing pregnancy and birth-related complications in sub-Saharan Africa: a systematic review |
title_full | Patient and health system costs of managing pregnancy and birth-related complications in sub-Saharan Africa: a systematic review |
title_fullStr | Patient and health system costs of managing pregnancy and birth-related complications in sub-Saharan Africa: a systematic review |
title_full_unstemmed | Patient and health system costs of managing pregnancy and birth-related complications in sub-Saharan Africa: a systematic review |
title_short | Patient and health system costs of managing pregnancy and birth-related complications in sub-Saharan Africa: a systematic review |
title_sort | patient and health system costs of managing pregnancy and birth-related complications in sub-saharan africa: a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7429732/ https://www.ncbi.nlm.nih.gov/pubmed/32803373 http://dx.doi.org/10.1186/s13561-020-00283-y |
work_keys_str_mv | AT moriamanithomas patientandhealthsystemcostsofmanagingpregnancyandbirthrelatedcomplicationsinsubsaharanafricaasystematicreview AT binyarukapeter patientandhealthsystemcostsofmanagingpregnancyandbirthrelatedcomplicationsinsubsaharanafricaasystematicreview AT hangomapeter patientandhealthsystemcostsofmanagingpregnancyandbirthrelatedcomplicationsinsubsaharanafricaasystematicreview AT robberstadbjarne patientandhealthsystemcostsofmanagingpregnancyandbirthrelatedcomplicationsinsubsaharanafricaasystematicreview AT sandoyingvild patientandhealthsystemcostsofmanagingpregnancyandbirthrelatedcomplicationsinsubsaharanafricaasystematicreview |