Cargando…
A decrease in NAMPT activity impairs basal PARP-1 activity in cytidine deaminase deficient-cells, independently of NAD(+)
Cytidine deaminase (CDA) deficiency causes pyrimidine pool disequilibrium. We previously reported that the excess cellular dC and dCTP resulting from CDA deficiency jeopardizes genome stability, decreasing basal poly(ADP-ribose) polymerase 1 (PARP-1) activity and increasing ultrafine anaphase bridge...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7431583/ https://www.ncbi.nlm.nih.gov/pubmed/32807821 http://dx.doi.org/10.1038/s41598-020-70874-6 |
_version_ | 1783571612608495616 |
---|---|
author | Silveira, Sandra Cunha Buhagiar-Labarchède, Géraldine Onclercq-Delic, Rosine Gemble, Simon Bou Samra, Elias Mameri, Hamza Duchambon, Patricia Machon, Christelle Guitton, Jérôme Amor-Guéret, Mounira |
author_facet | Silveira, Sandra Cunha Buhagiar-Labarchède, Géraldine Onclercq-Delic, Rosine Gemble, Simon Bou Samra, Elias Mameri, Hamza Duchambon, Patricia Machon, Christelle Guitton, Jérôme Amor-Guéret, Mounira |
author_sort | Silveira, Sandra Cunha |
collection | PubMed |
description | Cytidine deaminase (CDA) deficiency causes pyrimidine pool disequilibrium. We previously reported that the excess cellular dC and dCTP resulting from CDA deficiency jeopardizes genome stability, decreasing basal poly(ADP-ribose) polymerase 1 (PARP-1) activity and increasing ultrafine anaphase bridge (UFB) formation. Here, we investigated the mechanism underlying the decrease in PARP-1 activity in CDA-deficient cells. PARP-1 activity is dependent on intracellular NAD(+) concentration. We therefore hypothesized that defects of the NAD(+) salvage pathway might result in decreases in PARP-1 activity. We found that the inhibition or depletion of nicotinamide phosphoribosyltransferase (NAMPT), the rate-limiting enzyme in the NAD(+) salvage biosynthesis pathway, mimicked CDA deficiency, resulting in a decrease in basal PARP-1 activity, regardless of NAD(+) levels. Furthermore, the expression of exogenous wild-type NAMPT fully restored basal PARP-1 activity and prevented the increase in UFB frequency in CDA-deficient cells. No such effect was observed with the catalytic mutant. Our findings demonstrate that (1) the inhibition of NAMPT activity in CDA-proficient cells lowers basal PARP-1 activity, and (2) the expression of exogenous wild-type NAMPT, but not of the catalytic mutant, fully restores basal PARP-1 activity in CDA-deficient cells; these results strongly suggest that basal PARP-1 activity in CDA-deficient cells decreases due to a reduction of NAMPT activity. |
format | Online Article Text |
id | pubmed-7431583 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-74315832020-08-18 A decrease in NAMPT activity impairs basal PARP-1 activity in cytidine deaminase deficient-cells, independently of NAD(+) Silveira, Sandra Cunha Buhagiar-Labarchède, Géraldine Onclercq-Delic, Rosine Gemble, Simon Bou Samra, Elias Mameri, Hamza Duchambon, Patricia Machon, Christelle Guitton, Jérôme Amor-Guéret, Mounira Sci Rep Article Cytidine deaminase (CDA) deficiency causes pyrimidine pool disequilibrium. We previously reported that the excess cellular dC and dCTP resulting from CDA deficiency jeopardizes genome stability, decreasing basal poly(ADP-ribose) polymerase 1 (PARP-1) activity and increasing ultrafine anaphase bridge (UFB) formation. Here, we investigated the mechanism underlying the decrease in PARP-1 activity in CDA-deficient cells. PARP-1 activity is dependent on intracellular NAD(+) concentration. We therefore hypothesized that defects of the NAD(+) salvage pathway might result in decreases in PARP-1 activity. We found that the inhibition or depletion of nicotinamide phosphoribosyltransferase (NAMPT), the rate-limiting enzyme in the NAD(+) salvage biosynthesis pathway, mimicked CDA deficiency, resulting in a decrease in basal PARP-1 activity, regardless of NAD(+) levels. Furthermore, the expression of exogenous wild-type NAMPT fully restored basal PARP-1 activity and prevented the increase in UFB frequency in CDA-deficient cells. No such effect was observed with the catalytic mutant. Our findings demonstrate that (1) the inhibition of NAMPT activity in CDA-proficient cells lowers basal PARP-1 activity, and (2) the expression of exogenous wild-type NAMPT, but not of the catalytic mutant, fully restores basal PARP-1 activity in CDA-deficient cells; these results strongly suggest that basal PARP-1 activity in CDA-deficient cells decreases due to a reduction of NAMPT activity. Nature Publishing Group UK 2020-08-17 /pmc/articles/PMC7431583/ /pubmed/32807821 http://dx.doi.org/10.1038/s41598-020-70874-6 Text en © The Author(s) 2020 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Article Silveira, Sandra Cunha Buhagiar-Labarchède, Géraldine Onclercq-Delic, Rosine Gemble, Simon Bou Samra, Elias Mameri, Hamza Duchambon, Patricia Machon, Christelle Guitton, Jérôme Amor-Guéret, Mounira A decrease in NAMPT activity impairs basal PARP-1 activity in cytidine deaminase deficient-cells, independently of NAD(+) |
title | A decrease in NAMPT activity impairs basal PARP-1 activity in cytidine deaminase deficient-cells, independently of NAD(+) |
title_full | A decrease in NAMPT activity impairs basal PARP-1 activity in cytidine deaminase deficient-cells, independently of NAD(+) |
title_fullStr | A decrease in NAMPT activity impairs basal PARP-1 activity in cytidine deaminase deficient-cells, independently of NAD(+) |
title_full_unstemmed | A decrease in NAMPT activity impairs basal PARP-1 activity in cytidine deaminase deficient-cells, independently of NAD(+) |
title_short | A decrease in NAMPT activity impairs basal PARP-1 activity in cytidine deaminase deficient-cells, independently of NAD(+) |
title_sort | decrease in nampt activity impairs basal parp-1 activity in cytidine deaminase deficient-cells, independently of nad(+) |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7431583/ https://www.ncbi.nlm.nih.gov/pubmed/32807821 http://dx.doi.org/10.1038/s41598-020-70874-6 |
work_keys_str_mv | AT silveirasandracunha adecreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT buhagiarlabarchedegeraldine adecreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT onclercqdelicrosine adecreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT gemblesimon adecreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT bousamraelias adecreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT mamerihamza adecreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT duchambonpatricia adecreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT machonchristelle adecreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT guittonjerome adecreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT amorgueretmounira adecreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT silveirasandracunha decreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT buhagiarlabarchedegeraldine decreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT onclercqdelicrosine decreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT gemblesimon decreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT bousamraelias decreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT mamerihamza decreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT duchambonpatricia decreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT machonchristelle decreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT guittonjerome decreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad AT amorgueretmounira decreaseinnamptactivityimpairsbasalparp1activityincytidinedeaminasedeficientcellsindependentlyofnad |