Cargando…

Cherubism as a systemic skeletal disease: evidence from an aggressive case

BACKGROUND: Cherubism is a rare autosomal dominant genetic condition caused by mutations in the SH3BP2 gene. This disease is characterized by osteolysis of the jaws, with the bone replaced by soft tissue rich in fibroblasts and multinuclear giant cells. SH3BP2 is a ubiquitous adaptor protein yet the...

Descripción completa

Detalles Bibliográficos
Autores principales: Morice, Anne, Joly, Aline, Ricquebourg, Manon, Maruani, Gérard, Durand, Emmanuel, Galmiche, Louise, Amiel, Jeanne, Vial, Yoann, Cavé, Hélène, Belhous, Kahina, Piketty, Marie, Cohen-Solal, Martine, Berdal, Ariane, Collet, Corinne, Picard, Arnaud, Coudert, Amelie E., Kadlub, Natacha
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7441549/
https://www.ncbi.nlm.nih.gov/pubmed/32825821
http://dx.doi.org/10.1186/s12891-020-03580-z
_version_ 1783573315426713600
author Morice, Anne
Joly, Aline
Ricquebourg, Manon
Maruani, Gérard
Durand, Emmanuel
Galmiche, Louise
Amiel, Jeanne
Vial, Yoann
Cavé, Hélène
Belhous, Kahina
Piketty, Marie
Cohen-Solal, Martine
Berdal, Ariane
Collet, Corinne
Picard, Arnaud
Coudert, Amelie E.
Kadlub, Natacha
author_facet Morice, Anne
Joly, Aline
Ricquebourg, Manon
Maruani, Gérard
Durand, Emmanuel
Galmiche, Louise
Amiel, Jeanne
Vial, Yoann
Cavé, Hélène
Belhous, Kahina
Piketty, Marie
Cohen-Solal, Martine
Berdal, Ariane
Collet, Corinne
Picard, Arnaud
Coudert, Amelie E.
Kadlub, Natacha
author_sort Morice, Anne
collection PubMed
description BACKGROUND: Cherubism is a rare autosomal dominant genetic condition caused by mutations in the SH3BP2 gene. This disease is characterized by osteolysis of the jaws, with the bone replaced by soft tissue rich in fibroblasts and multinuclear giant cells. SH3BP2 is a ubiquitous adaptor protein yet the consequences of SH3BP2 mutation have so far been described as impacting only face. Cherubism mouse models have been generated and unlike human patients, the knock-in mice exhibit systemic bone loss together with a systemic inflammation. CASE PRESENTATION: In light of these observations, we decided to search for a systemic cherubism phenotype in a 6-year-old girl with an aggressive cherubism. We report here the first case of cherubism with systemic manifestations. Bone densitometry showed low overall bone density (total body Z-score = − 4.6 SD). Several markers of bone remodelling (CTx, BALP, P1NP) as well as inflammation (TNFα and IL-1) were elevated. A causative second-site mutation in other genes known to influence bone density was ruled out by sequencing a panel of such genes. CONCLUSIONS: If this systemic skeletal cherubism phenotype should be confirmed, it would simplify the treatment of severe cherubism patients and allay reservations about applying a systemic treatment such as those recently published (tacrolimus or imatinib) to a disease heretofore believed to be localised to the jaws.
format Online
Article
Text
id pubmed-7441549
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-74415492020-08-24 Cherubism as a systemic skeletal disease: evidence from an aggressive case Morice, Anne Joly, Aline Ricquebourg, Manon Maruani, Gérard Durand, Emmanuel Galmiche, Louise Amiel, Jeanne Vial, Yoann Cavé, Hélène Belhous, Kahina Piketty, Marie Cohen-Solal, Martine Berdal, Ariane Collet, Corinne Picard, Arnaud Coudert, Amelie E. Kadlub, Natacha BMC Musculoskelet Disord Case Report BACKGROUND: Cherubism is a rare autosomal dominant genetic condition caused by mutations in the SH3BP2 gene. This disease is characterized by osteolysis of the jaws, with the bone replaced by soft tissue rich in fibroblasts and multinuclear giant cells. SH3BP2 is a ubiquitous adaptor protein yet the consequences of SH3BP2 mutation have so far been described as impacting only face. Cherubism mouse models have been generated and unlike human patients, the knock-in mice exhibit systemic bone loss together with a systemic inflammation. CASE PRESENTATION: In light of these observations, we decided to search for a systemic cherubism phenotype in a 6-year-old girl with an aggressive cherubism. We report here the first case of cherubism with systemic manifestations. Bone densitometry showed low overall bone density (total body Z-score = − 4.6 SD). Several markers of bone remodelling (CTx, BALP, P1NP) as well as inflammation (TNFα and IL-1) were elevated. A causative second-site mutation in other genes known to influence bone density was ruled out by sequencing a panel of such genes. CONCLUSIONS: If this systemic skeletal cherubism phenotype should be confirmed, it would simplify the treatment of severe cherubism patients and allay reservations about applying a systemic treatment such as those recently published (tacrolimus or imatinib) to a disease heretofore believed to be localised to the jaws. BioMed Central 2020-08-21 /pmc/articles/PMC7441549/ /pubmed/32825821 http://dx.doi.org/10.1186/s12891-020-03580-z Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Case Report
Morice, Anne
Joly, Aline
Ricquebourg, Manon
Maruani, Gérard
Durand, Emmanuel
Galmiche, Louise
Amiel, Jeanne
Vial, Yoann
Cavé, Hélène
Belhous, Kahina
Piketty, Marie
Cohen-Solal, Martine
Berdal, Ariane
Collet, Corinne
Picard, Arnaud
Coudert, Amelie E.
Kadlub, Natacha
Cherubism as a systemic skeletal disease: evidence from an aggressive case
title Cherubism as a systemic skeletal disease: evidence from an aggressive case
title_full Cherubism as a systemic skeletal disease: evidence from an aggressive case
title_fullStr Cherubism as a systemic skeletal disease: evidence from an aggressive case
title_full_unstemmed Cherubism as a systemic skeletal disease: evidence from an aggressive case
title_short Cherubism as a systemic skeletal disease: evidence from an aggressive case
title_sort cherubism as a systemic skeletal disease: evidence from an aggressive case
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7441549/
https://www.ncbi.nlm.nih.gov/pubmed/32825821
http://dx.doi.org/10.1186/s12891-020-03580-z
work_keys_str_mv AT moriceanne cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase
AT jolyaline cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase
AT ricquebourgmanon cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase
AT maruanigerard cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase
AT durandemmanuel cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase
AT galmichelouise cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase
AT amieljeanne cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase
AT vialyoann cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase
AT cavehelene cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase
AT belhouskahina cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase
AT pikettymarie cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase
AT cohensolalmartine cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase
AT berdalariane cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase
AT colletcorinne cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase
AT picardarnaud cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase
AT coudertameliee cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase
AT kadlubnatacha cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase