Cargando…
Cherubism as a systemic skeletal disease: evidence from an aggressive case
BACKGROUND: Cherubism is a rare autosomal dominant genetic condition caused by mutations in the SH3BP2 gene. This disease is characterized by osteolysis of the jaws, with the bone replaced by soft tissue rich in fibroblasts and multinuclear giant cells. SH3BP2 is a ubiquitous adaptor protein yet the...
Autores principales: | , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7441549/ https://www.ncbi.nlm.nih.gov/pubmed/32825821 http://dx.doi.org/10.1186/s12891-020-03580-z |
_version_ | 1783573315426713600 |
---|---|
author | Morice, Anne Joly, Aline Ricquebourg, Manon Maruani, Gérard Durand, Emmanuel Galmiche, Louise Amiel, Jeanne Vial, Yoann Cavé, Hélène Belhous, Kahina Piketty, Marie Cohen-Solal, Martine Berdal, Ariane Collet, Corinne Picard, Arnaud Coudert, Amelie E. Kadlub, Natacha |
author_facet | Morice, Anne Joly, Aline Ricquebourg, Manon Maruani, Gérard Durand, Emmanuel Galmiche, Louise Amiel, Jeanne Vial, Yoann Cavé, Hélène Belhous, Kahina Piketty, Marie Cohen-Solal, Martine Berdal, Ariane Collet, Corinne Picard, Arnaud Coudert, Amelie E. Kadlub, Natacha |
author_sort | Morice, Anne |
collection | PubMed |
description | BACKGROUND: Cherubism is a rare autosomal dominant genetic condition caused by mutations in the SH3BP2 gene. This disease is characterized by osteolysis of the jaws, with the bone replaced by soft tissue rich in fibroblasts and multinuclear giant cells. SH3BP2 is a ubiquitous adaptor protein yet the consequences of SH3BP2 mutation have so far been described as impacting only face. Cherubism mouse models have been generated and unlike human patients, the knock-in mice exhibit systemic bone loss together with a systemic inflammation. CASE PRESENTATION: In light of these observations, we decided to search for a systemic cherubism phenotype in a 6-year-old girl with an aggressive cherubism. We report here the first case of cherubism with systemic manifestations. Bone densitometry showed low overall bone density (total body Z-score = − 4.6 SD). Several markers of bone remodelling (CTx, BALP, P1NP) as well as inflammation (TNFα and IL-1) were elevated. A causative second-site mutation in other genes known to influence bone density was ruled out by sequencing a panel of such genes. CONCLUSIONS: If this systemic skeletal cherubism phenotype should be confirmed, it would simplify the treatment of severe cherubism patients and allay reservations about applying a systemic treatment such as those recently published (tacrolimus or imatinib) to a disease heretofore believed to be localised to the jaws. |
format | Online Article Text |
id | pubmed-7441549 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-74415492020-08-24 Cherubism as a systemic skeletal disease: evidence from an aggressive case Morice, Anne Joly, Aline Ricquebourg, Manon Maruani, Gérard Durand, Emmanuel Galmiche, Louise Amiel, Jeanne Vial, Yoann Cavé, Hélène Belhous, Kahina Piketty, Marie Cohen-Solal, Martine Berdal, Ariane Collet, Corinne Picard, Arnaud Coudert, Amelie E. Kadlub, Natacha BMC Musculoskelet Disord Case Report BACKGROUND: Cherubism is a rare autosomal dominant genetic condition caused by mutations in the SH3BP2 gene. This disease is characterized by osteolysis of the jaws, with the bone replaced by soft tissue rich in fibroblasts and multinuclear giant cells. SH3BP2 is a ubiquitous adaptor protein yet the consequences of SH3BP2 mutation have so far been described as impacting only face. Cherubism mouse models have been generated and unlike human patients, the knock-in mice exhibit systemic bone loss together with a systemic inflammation. CASE PRESENTATION: In light of these observations, we decided to search for a systemic cherubism phenotype in a 6-year-old girl with an aggressive cherubism. We report here the first case of cherubism with systemic manifestations. Bone densitometry showed low overall bone density (total body Z-score = − 4.6 SD). Several markers of bone remodelling (CTx, BALP, P1NP) as well as inflammation (TNFα and IL-1) were elevated. A causative second-site mutation in other genes known to influence bone density was ruled out by sequencing a panel of such genes. CONCLUSIONS: If this systemic skeletal cherubism phenotype should be confirmed, it would simplify the treatment of severe cherubism patients and allay reservations about applying a systemic treatment such as those recently published (tacrolimus or imatinib) to a disease heretofore believed to be localised to the jaws. BioMed Central 2020-08-21 /pmc/articles/PMC7441549/ /pubmed/32825821 http://dx.doi.org/10.1186/s12891-020-03580-z Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Case Report Morice, Anne Joly, Aline Ricquebourg, Manon Maruani, Gérard Durand, Emmanuel Galmiche, Louise Amiel, Jeanne Vial, Yoann Cavé, Hélène Belhous, Kahina Piketty, Marie Cohen-Solal, Martine Berdal, Ariane Collet, Corinne Picard, Arnaud Coudert, Amelie E. Kadlub, Natacha Cherubism as a systemic skeletal disease: evidence from an aggressive case |
title | Cherubism as a systemic skeletal disease: evidence from an aggressive case |
title_full | Cherubism as a systemic skeletal disease: evidence from an aggressive case |
title_fullStr | Cherubism as a systemic skeletal disease: evidence from an aggressive case |
title_full_unstemmed | Cherubism as a systemic skeletal disease: evidence from an aggressive case |
title_short | Cherubism as a systemic skeletal disease: evidence from an aggressive case |
title_sort | cherubism as a systemic skeletal disease: evidence from an aggressive case |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7441549/ https://www.ncbi.nlm.nih.gov/pubmed/32825821 http://dx.doi.org/10.1186/s12891-020-03580-z |
work_keys_str_mv | AT moriceanne cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase AT jolyaline cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase AT ricquebourgmanon cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase AT maruanigerard cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase AT durandemmanuel cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase AT galmichelouise cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase AT amieljeanne cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase AT vialyoann cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase AT cavehelene cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase AT belhouskahina cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase AT pikettymarie cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase AT cohensolalmartine cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase AT berdalariane cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase AT colletcorinne cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase AT picardarnaud cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase AT coudertameliee cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase AT kadlubnatacha cherubismasasystemicskeletaldiseaseevidencefromanaggressivecase |