Cargando…

Telomere length in granulosa cells and leukocytes: a potential marker of female fertility? A systematic review of the literature

In the context of a continuously increased delay of motherhood and of an increase of the incidence of premature ovarian failure, it is of the greatest interest to dispose of a predictive marker of the duration of the fertility window. Unfortunately, current available markers of women’s fertility (ho...

Descripción completa

Detalles Bibliográficos
Autores principales: Fattet, Anne-Julie, Toupance, Simon, Thornton, Simon N., Monnin, Nicolas, Guéant, Jean-Louis, Benetos, Athanase, Koscinski, Isabelle
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7442985/
https://www.ncbi.nlm.nih.gov/pubmed/32825843
http://dx.doi.org/10.1186/s13048-020-00702-y
_version_ 1783573544248016896
author Fattet, Anne-Julie
Toupance, Simon
Thornton, Simon N.
Monnin, Nicolas
Guéant, Jean-Louis
Benetos, Athanase
Koscinski, Isabelle
author_facet Fattet, Anne-Julie
Toupance, Simon
Thornton, Simon N.
Monnin, Nicolas
Guéant, Jean-Louis
Benetos, Athanase
Koscinski, Isabelle
author_sort Fattet, Anne-Julie
collection PubMed
description In the context of a continuously increased delay of motherhood and of an increase of the incidence of premature ovarian failure, it is of the greatest interest to dispose of a predictive marker of the duration of the fertility window. Unfortunately, current available markers of women’s fertility (hormonal rates or echography count of small follicles) have a poor predictive value of premature ovarian failure. In the last ten years, some studies have suggested that telomere length may be correlated with premature ovarian failure, but the results of these studies are contradictory. In accordance with guidelines from Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA), this systematic review of the literature selected studies evaluating telomere length or telomerase activity in granulosa cells and/or in leukocytes as a premature ovarian failure marker. Five publications (252 premature ovarian failure patients) were included in this review of experimental evidence. Two of them studied telomere length and/or telomerase activity in granulosa cells and 4 in leukocytes in women with premature ovarian failure. For each study, authors determined if there was a positive or a negative correlation between telomeric parameters and premature ovarian failure. 3 studies (178 premature ovarian failure patients) found shorter telomere length in granulosa cells and/or leukocytes and/or lower telomerase activity in premature ovarian failure patients. 2 studies (74 premature ovarian failure patients) presented contradictory results about the correlation of leucocyte telomere length with premature ovarian failure. Shorter telomeres and diminished telomerase activity in granulosa cells appear to be associated with ovarian insufficiency. However, the number of studies and of subjects within are low and the methodology questionable. The confirmation of these results is essential with more subjects, better defined populations and more adapted methodology, in order to consider telomere length in granulosa cells and/or in leucocytes as an early and reliable marker for the decline of ovarian function.
format Online
Article
Text
id pubmed-7442985
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-74429852020-08-24 Telomere length in granulosa cells and leukocytes: a potential marker of female fertility? A systematic review of the literature Fattet, Anne-Julie Toupance, Simon Thornton, Simon N. Monnin, Nicolas Guéant, Jean-Louis Benetos, Athanase Koscinski, Isabelle J Ovarian Res Review In the context of a continuously increased delay of motherhood and of an increase of the incidence of premature ovarian failure, it is of the greatest interest to dispose of a predictive marker of the duration of the fertility window. Unfortunately, current available markers of women’s fertility (hormonal rates or echography count of small follicles) have a poor predictive value of premature ovarian failure. In the last ten years, some studies have suggested that telomere length may be correlated with premature ovarian failure, but the results of these studies are contradictory. In accordance with guidelines from Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA), this systematic review of the literature selected studies evaluating telomere length or telomerase activity in granulosa cells and/or in leukocytes as a premature ovarian failure marker. Five publications (252 premature ovarian failure patients) were included in this review of experimental evidence. Two of them studied telomere length and/or telomerase activity in granulosa cells and 4 in leukocytes in women with premature ovarian failure. For each study, authors determined if there was a positive or a negative correlation between telomeric parameters and premature ovarian failure. 3 studies (178 premature ovarian failure patients) found shorter telomere length in granulosa cells and/or leukocytes and/or lower telomerase activity in premature ovarian failure patients. 2 studies (74 premature ovarian failure patients) presented contradictory results about the correlation of leucocyte telomere length with premature ovarian failure. Shorter telomeres and diminished telomerase activity in granulosa cells appear to be associated with ovarian insufficiency. However, the number of studies and of subjects within are low and the methodology questionable. The confirmation of these results is essential with more subjects, better defined populations and more adapted methodology, in order to consider telomere length in granulosa cells and/or in leucocytes as an early and reliable marker for the decline of ovarian function. BioMed Central 2020-08-21 /pmc/articles/PMC7442985/ /pubmed/32825843 http://dx.doi.org/10.1186/s13048-020-00702-y Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Review
Fattet, Anne-Julie
Toupance, Simon
Thornton, Simon N.
Monnin, Nicolas
Guéant, Jean-Louis
Benetos, Athanase
Koscinski, Isabelle
Telomere length in granulosa cells and leukocytes: a potential marker of female fertility? A systematic review of the literature
title Telomere length in granulosa cells and leukocytes: a potential marker of female fertility? A systematic review of the literature
title_full Telomere length in granulosa cells and leukocytes: a potential marker of female fertility? A systematic review of the literature
title_fullStr Telomere length in granulosa cells and leukocytes: a potential marker of female fertility? A systematic review of the literature
title_full_unstemmed Telomere length in granulosa cells and leukocytes: a potential marker of female fertility? A systematic review of the literature
title_short Telomere length in granulosa cells and leukocytes: a potential marker of female fertility? A systematic review of the literature
title_sort telomere length in granulosa cells and leukocytes: a potential marker of female fertility? a systematic review of the literature
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7442985/
https://www.ncbi.nlm.nih.gov/pubmed/32825843
http://dx.doi.org/10.1186/s13048-020-00702-y
work_keys_str_mv AT fattetannejulie telomerelengthingranulosacellsandleukocytesapotentialmarkeroffemalefertilityasystematicreviewoftheliterature
AT toupancesimon telomerelengthingranulosacellsandleukocytesapotentialmarkeroffemalefertilityasystematicreviewoftheliterature
AT thorntonsimonn telomerelengthingranulosacellsandleukocytesapotentialmarkeroffemalefertilityasystematicreviewoftheliterature
AT monninnicolas telomerelengthingranulosacellsandleukocytesapotentialmarkeroffemalefertilityasystematicreviewoftheliterature
AT gueantjeanlouis telomerelengthingranulosacellsandleukocytesapotentialmarkeroffemalefertilityasystematicreviewoftheliterature
AT benetosathanase telomerelengthingranulosacellsandleukocytesapotentialmarkeroffemalefertilityasystematicreviewoftheliterature
AT koscinskiisabelle telomerelengthingranulosacellsandleukocytesapotentialmarkeroffemalefertilityasystematicreviewoftheliterature