Cargando…
Manipulation of Quercetin and Melatonin in the Down-Regulation of HIF-1α, HSP-70 and VEGF Pathways in Rat’s Kidneys Induced by Hypoxic Stress
Hypoxia may lead to inflammatory responses by numerous signaling pathways. This investigation intended to inspect the defensive role of Quercetin (Quer) and/ or Melatonin (Mel) against reno toxicity induced by Sodium nitrite (Sod ntr). Sod ntr injection significantly decreased blood hemoglobin conce...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
SAGE Publications
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7457675/ https://www.ncbi.nlm.nih.gov/pubmed/32922227 http://dx.doi.org/10.1177/1559325820949797 |
_version_ | 1783576043306614784 |
---|---|
author | Alshanwani, Aliah R. Shaheen, Sameerah Faddah, Laila M. Alhusaini, Ahlam M. Ali, Hanaa M. Hasan, Iman Hagar, Hanan Ahmed, Raeesa Alharbi, Fatima M. B. AlHarthii, Alaa |
author_facet | Alshanwani, Aliah R. Shaheen, Sameerah Faddah, Laila M. Alhusaini, Ahlam M. Ali, Hanaa M. Hasan, Iman Hagar, Hanan Ahmed, Raeesa Alharbi, Fatima M. B. AlHarthii, Alaa |
author_sort | Alshanwani, Aliah R. |
collection | PubMed |
description | Hypoxia may lead to inflammatory responses by numerous signaling pathways. This investigation intended to inspect the defensive role of Quercetin (Quer) and/ or Melatonin (Mel) against reno toxicity induced by Sodium nitrite (Sod ntr). Sod ntr injection significantly decreased blood hemoglobin concentration (Hb) with a concurrent increase in serum tumor necrosis factor- α, interleukin-6, C-reactive protein, creatinine, and urea levels. Over protein-expression of vascular endothelial growth factor and heat shock, protein-70 and mRNA of HIF-1α were also observed. Pretreatment of the Sod ntr- injected rats with the aforementioned antioxidants; either alone or together significantly improved such parameters. Histopathological examination reinforced the previous results. It was concluded that the combined administration of Quer and Mel may be useful as a potential therapy against renal injury induced by Sod ntr. HIF-1α and HSP-70 are implicated in the induction of hypoxia and its treatment. |
format | Online Article Text |
id | pubmed-7457675 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | SAGE Publications |
record_format | MEDLINE/PubMed |
spelling | pubmed-74576752020-09-11 Manipulation of Quercetin and Melatonin in the Down-Regulation of HIF-1α, HSP-70 and VEGF Pathways in Rat’s Kidneys Induced by Hypoxic Stress Alshanwani, Aliah R. Shaheen, Sameerah Faddah, Laila M. Alhusaini, Ahlam M. Ali, Hanaa M. Hasan, Iman Hagar, Hanan Ahmed, Raeesa Alharbi, Fatima M. B. AlHarthii, Alaa Dose Response Original Article Hypoxia may lead to inflammatory responses by numerous signaling pathways. This investigation intended to inspect the defensive role of Quercetin (Quer) and/ or Melatonin (Mel) against reno toxicity induced by Sodium nitrite (Sod ntr). Sod ntr injection significantly decreased blood hemoglobin concentration (Hb) with a concurrent increase in serum tumor necrosis factor- α, interleukin-6, C-reactive protein, creatinine, and urea levels. Over protein-expression of vascular endothelial growth factor and heat shock, protein-70 and mRNA of HIF-1α were also observed. Pretreatment of the Sod ntr- injected rats with the aforementioned antioxidants; either alone or together significantly improved such parameters. Histopathological examination reinforced the previous results. It was concluded that the combined administration of Quer and Mel may be useful as a potential therapy against renal injury induced by Sod ntr. HIF-1α and HSP-70 are implicated in the induction of hypoxia and its treatment. SAGE Publications 2020-08-28 /pmc/articles/PMC7457675/ /pubmed/32922227 http://dx.doi.org/10.1177/1559325820949797 Text en © The Author(s) 2020 https://creativecommons.org/licenses/by-nc/4.0/ This article is distributed under the terms of the Creative Commons Attribution-NonCommercial 4.0 License (https://creativecommons.org/licenses/by-nc/4.0/) which permits non-commercial use, reproduction and distribution of the work without further permission provided the original work is attributed as specified on the SAGE and Open Access pages (https://us.sagepub.com/en-us/nam/open-access-at-sage). |
spellingShingle | Original Article Alshanwani, Aliah R. Shaheen, Sameerah Faddah, Laila M. Alhusaini, Ahlam M. Ali, Hanaa M. Hasan, Iman Hagar, Hanan Ahmed, Raeesa Alharbi, Fatima M. B. AlHarthii, Alaa Manipulation of Quercetin and Melatonin in the Down-Regulation of HIF-1α, HSP-70 and VEGF Pathways in Rat’s Kidneys Induced by Hypoxic Stress |
title | Manipulation of Quercetin and Melatonin in the Down-Regulation of
HIF-1α, HSP-70 and VEGF Pathways in Rat’s Kidneys Induced by Hypoxic
Stress |
title_full | Manipulation of Quercetin and Melatonin in the Down-Regulation of
HIF-1α, HSP-70 and VEGF Pathways in Rat’s Kidneys Induced by Hypoxic
Stress |
title_fullStr | Manipulation of Quercetin and Melatonin in the Down-Regulation of
HIF-1α, HSP-70 and VEGF Pathways in Rat’s Kidneys Induced by Hypoxic
Stress |
title_full_unstemmed | Manipulation of Quercetin and Melatonin in the Down-Regulation of
HIF-1α, HSP-70 and VEGF Pathways in Rat’s Kidneys Induced by Hypoxic
Stress |
title_short | Manipulation of Quercetin and Melatonin in the Down-Regulation of
HIF-1α, HSP-70 and VEGF Pathways in Rat’s Kidneys Induced by Hypoxic
Stress |
title_sort | manipulation of quercetin and melatonin in the down-regulation of
hif-1α, hsp-70 and vegf pathways in rat’s kidneys induced by hypoxic
stress |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7457675/ https://www.ncbi.nlm.nih.gov/pubmed/32922227 http://dx.doi.org/10.1177/1559325820949797 |
work_keys_str_mv | AT alshanwanialiahr manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress AT shaheensameerah manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress AT faddahlailam manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress AT alhusainiahlamm manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress AT alihanaam manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress AT hasaniman manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress AT hagarhanan manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress AT ahmedraeesa manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress AT alharbifatimamb manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress AT alharthiialaa manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress |