Cargando…

Manipulation of Quercetin and Melatonin in the Down-Regulation of HIF-1α, HSP-70 and VEGF Pathways in Rat’s Kidneys Induced by Hypoxic Stress

Hypoxia may lead to inflammatory responses by numerous signaling pathways. This investigation intended to inspect the defensive role of Quercetin (Quer) and/ or Melatonin (Mel) against reno toxicity induced by Sodium nitrite (Sod ntr). Sod ntr injection significantly decreased blood hemoglobin conce...

Descripción completa

Detalles Bibliográficos
Autores principales: Alshanwani, Aliah R., Shaheen, Sameerah, Faddah, Laila M., Alhusaini, Ahlam M., Ali, Hanaa M., Hasan, Iman, Hagar, Hanan, Ahmed, Raeesa, Alharbi, Fatima M. B., AlHarthii, Alaa
Formato: Online Artículo Texto
Lenguaje:English
Publicado: SAGE Publications 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7457675/
https://www.ncbi.nlm.nih.gov/pubmed/32922227
http://dx.doi.org/10.1177/1559325820949797
_version_ 1783576043306614784
author Alshanwani, Aliah R.
Shaheen, Sameerah
Faddah, Laila M.
Alhusaini, Ahlam M.
Ali, Hanaa M.
Hasan, Iman
Hagar, Hanan
Ahmed, Raeesa
Alharbi, Fatima M. B.
AlHarthii, Alaa
author_facet Alshanwani, Aliah R.
Shaheen, Sameerah
Faddah, Laila M.
Alhusaini, Ahlam M.
Ali, Hanaa M.
Hasan, Iman
Hagar, Hanan
Ahmed, Raeesa
Alharbi, Fatima M. B.
AlHarthii, Alaa
author_sort Alshanwani, Aliah R.
collection PubMed
description Hypoxia may lead to inflammatory responses by numerous signaling pathways. This investigation intended to inspect the defensive role of Quercetin (Quer) and/ or Melatonin (Mel) against reno toxicity induced by Sodium nitrite (Sod ntr). Sod ntr injection significantly decreased blood hemoglobin concentration (Hb) with a concurrent increase in serum tumor necrosis factor- α, interleukin-6, C-reactive protein, creatinine, and urea levels. Over protein-expression of vascular endothelial growth factor and heat shock, protein-70 and mRNA of HIF-1α were also observed. Pretreatment of the Sod ntr- injected rats with the aforementioned antioxidants; either alone or together significantly improved such parameters. Histopathological examination reinforced the previous results. It was concluded that the combined administration of Quer and Mel may be useful as a potential therapy against renal injury induced by Sod ntr. HIF-1α and HSP-70 are implicated in the induction of hypoxia and its treatment.
format Online
Article
Text
id pubmed-7457675
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher SAGE Publications
record_format MEDLINE/PubMed
spelling pubmed-74576752020-09-11 Manipulation of Quercetin and Melatonin in the Down-Regulation of HIF-1α, HSP-70 and VEGF Pathways in Rat’s Kidneys Induced by Hypoxic Stress Alshanwani, Aliah R. Shaheen, Sameerah Faddah, Laila M. Alhusaini, Ahlam M. Ali, Hanaa M. Hasan, Iman Hagar, Hanan Ahmed, Raeesa Alharbi, Fatima M. B. AlHarthii, Alaa Dose Response Original Article Hypoxia may lead to inflammatory responses by numerous signaling pathways. This investigation intended to inspect the defensive role of Quercetin (Quer) and/ or Melatonin (Mel) against reno toxicity induced by Sodium nitrite (Sod ntr). Sod ntr injection significantly decreased blood hemoglobin concentration (Hb) with a concurrent increase in serum tumor necrosis factor- α, interleukin-6, C-reactive protein, creatinine, and urea levels. Over protein-expression of vascular endothelial growth factor and heat shock, protein-70 and mRNA of HIF-1α were also observed. Pretreatment of the Sod ntr- injected rats with the aforementioned antioxidants; either alone or together significantly improved such parameters. Histopathological examination reinforced the previous results. It was concluded that the combined administration of Quer and Mel may be useful as a potential therapy against renal injury induced by Sod ntr. HIF-1α and HSP-70 are implicated in the induction of hypoxia and its treatment. SAGE Publications 2020-08-28 /pmc/articles/PMC7457675/ /pubmed/32922227 http://dx.doi.org/10.1177/1559325820949797 Text en © The Author(s) 2020 https://creativecommons.org/licenses/by-nc/4.0/ This article is distributed under the terms of the Creative Commons Attribution-NonCommercial 4.0 License (https://creativecommons.org/licenses/by-nc/4.0/) which permits non-commercial use, reproduction and distribution of the work without further permission provided the original work is attributed as specified on the SAGE and Open Access pages (https://us.sagepub.com/en-us/nam/open-access-at-sage).
spellingShingle Original Article
Alshanwani, Aliah R.
Shaheen, Sameerah
Faddah, Laila M.
Alhusaini, Ahlam M.
Ali, Hanaa M.
Hasan, Iman
Hagar, Hanan
Ahmed, Raeesa
Alharbi, Fatima M. B.
AlHarthii, Alaa
Manipulation of Quercetin and Melatonin in the Down-Regulation of HIF-1α, HSP-70 and VEGF Pathways in Rat’s Kidneys Induced by Hypoxic Stress
title Manipulation of Quercetin and Melatonin in the Down-Regulation of HIF-1α, HSP-70 and VEGF Pathways in Rat’s Kidneys Induced by Hypoxic Stress
title_full Manipulation of Quercetin and Melatonin in the Down-Regulation of HIF-1α, HSP-70 and VEGF Pathways in Rat’s Kidneys Induced by Hypoxic Stress
title_fullStr Manipulation of Quercetin and Melatonin in the Down-Regulation of HIF-1α, HSP-70 and VEGF Pathways in Rat’s Kidneys Induced by Hypoxic Stress
title_full_unstemmed Manipulation of Quercetin and Melatonin in the Down-Regulation of HIF-1α, HSP-70 and VEGF Pathways in Rat’s Kidneys Induced by Hypoxic Stress
title_short Manipulation of Quercetin and Melatonin in the Down-Regulation of HIF-1α, HSP-70 and VEGF Pathways in Rat’s Kidneys Induced by Hypoxic Stress
title_sort manipulation of quercetin and melatonin in the down-regulation of hif-1α, hsp-70 and vegf pathways in rat’s kidneys induced by hypoxic stress
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7457675/
https://www.ncbi.nlm.nih.gov/pubmed/32922227
http://dx.doi.org/10.1177/1559325820949797
work_keys_str_mv AT alshanwanialiahr manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress
AT shaheensameerah manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress
AT faddahlailam manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress
AT alhusainiahlamm manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress
AT alihanaam manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress
AT hasaniman manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress
AT hagarhanan manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress
AT ahmedraeesa manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress
AT alharbifatimamb manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress
AT alharthiialaa manipulationofquercetinandmelatonininthedownregulationofhif1ahsp70andvegfpathwaysinratskidneysinducedbyhypoxicstress