Cargando…
Dysfunction of dimorphic sperm impairs male fertility in the silkworm
Sperm, which have a vital role in sexual reproduction in the animal kingdom, can display heteromorphism in some species. The regulation of sperm dichotomy remains a longstanding puzzle even though the phenomenon has been widely documented for over a century. Here we use Bombyx mori as a model to stu...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer Singapore
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7477584/ https://www.ncbi.nlm.nih.gov/pubmed/32963806 http://dx.doi.org/10.1038/s41421-020-00194-6 |
_version_ | 1783579932758114304 |
---|---|
author | Chen, Shuqing Liu, Yujia Yang, Xu Liu, Zulian Luo, Xingyu Xu, Jun Huang, Yongping |
author_facet | Chen, Shuqing Liu, Yujia Yang, Xu Liu, Zulian Luo, Xingyu Xu, Jun Huang, Yongping |
author_sort | Chen, Shuqing |
collection | PubMed |
description | Sperm, which have a vital role in sexual reproduction in the animal kingdom, can display heteromorphism in some species. The regulation of sperm dichotomy remains a longstanding puzzle even though the phenomenon has been widely documented for over a century. Here we use Bombyx mori as a model to study a form of sperm dimorphism (eupyrene and apyrene sperm), which is nearly universal among Lepidoptera. We demonstrate that B. mori Sex-lethal (BmSxl) is crucial for apyrene sperm development, and that B. mori poly(A)-specific ribonuclease-like domain-containing 1 (BmPnldc1) is required for eupyrene sperm development. BmSXL is distributed in the nuclei and cytoplasm of somatic cyst cells in a mesh-like pattern and in the cytoplasm of germ cells enclosed in spermatocysts and sperm bundles. Cytological analyses of dimorphic sperm in BmSxl mutants (∆BmSxl) showed deficient apyrene sperm with abnormal nuclei, as well as loss of motility associated with malformed mitochondrial derivatives. We define the crucial function of apyrene sperm in the process of fertilization as assisting the migration of eupyrene spermatozoa from bursa copulatrix to spermatheca. By contrast, BmPnldc1 deficiency (∆BmPnldc1) caused eupyrene sperm abnormalities and impaired the release of eupyrene sperm bundles during spermiation. Although apyrene or eupyrene sperm defects impaired fertility of the mutated males, double copulation of a wild-type female with ∆BmSxl and ∆BmPnldc1 males could rescue the sterility phenotypes induced by single copulation with either gene-deficient male. Our findings demonstrate the crucial functions of BmSxl and BmPnldc1 in the development of sperm dimorphism and the indispensable roles of nonfertile apyrene sperm in fertilization. |
format | Online Article Text |
id | pubmed-7477584 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Springer Singapore |
record_format | MEDLINE/PubMed |
spelling | pubmed-74775842020-09-21 Dysfunction of dimorphic sperm impairs male fertility in the silkworm Chen, Shuqing Liu, Yujia Yang, Xu Liu, Zulian Luo, Xingyu Xu, Jun Huang, Yongping Cell Discov Article Sperm, which have a vital role in sexual reproduction in the animal kingdom, can display heteromorphism in some species. The regulation of sperm dichotomy remains a longstanding puzzle even though the phenomenon has been widely documented for over a century. Here we use Bombyx mori as a model to study a form of sperm dimorphism (eupyrene and apyrene sperm), which is nearly universal among Lepidoptera. We demonstrate that B. mori Sex-lethal (BmSxl) is crucial for apyrene sperm development, and that B. mori poly(A)-specific ribonuclease-like domain-containing 1 (BmPnldc1) is required for eupyrene sperm development. BmSXL is distributed in the nuclei and cytoplasm of somatic cyst cells in a mesh-like pattern and in the cytoplasm of germ cells enclosed in spermatocysts and sperm bundles. Cytological analyses of dimorphic sperm in BmSxl mutants (∆BmSxl) showed deficient apyrene sperm with abnormal nuclei, as well as loss of motility associated with malformed mitochondrial derivatives. We define the crucial function of apyrene sperm in the process of fertilization as assisting the migration of eupyrene spermatozoa from bursa copulatrix to spermatheca. By contrast, BmPnldc1 deficiency (∆BmPnldc1) caused eupyrene sperm abnormalities and impaired the release of eupyrene sperm bundles during spermiation. Although apyrene or eupyrene sperm defects impaired fertility of the mutated males, double copulation of a wild-type female with ∆BmSxl and ∆BmPnldc1 males could rescue the sterility phenotypes induced by single copulation with either gene-deficient male. Our findings demonstrate the crucial functions of BmSxl and BmPnldc1 in the development of sperm dimorphism and the indispensable roles of nonfertile apyrene sperm in fertilization. Springer Singapore 2020-09-08 /pmc/articles/PMC7477584/ /pubmed/32963806 http://dx.doi.org/10.1038/s41421-020-00194-6 Text en © The Author(s) 2020 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Article Chen, Shuqing Liu, Yujia Yang, Xu Liu, Zulian Luo, Xingyu Xu, Jun Huang, Yongping Dysfunction of dimorphic sperm impairs male fertility in the silkworm |
title | Dysfunction of dimorphic sperm impairs male fertility in the silkworm |
title_full | Dysfunction of dimorphic sperm impairs male fertility in the silkworm |
title_fullStr | Dysfunction of dimorphic sperm impairs male fertility in the silkworm |
title_full_unstemmed | Dysfunction of dimorphic sperm impairs male fertility in the silkworm |
title_short | Dysfunction of dimorphic sperm impairs male fertility in the silkworm |
title_sort | dysfunction of dimorphic sperm impairs male fertility in the silkworm |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7477584/ https://www.ncbi.nlm.nih.gov/pubmed/32963806 http://dx.doi.org/10.1038/s41421-020-00194-6 |
work_keys_str_mv | AT chenshuqing dysfunctionofdimorphicspermimpairsmalefertilityinthesilkworm AT liuyujia dysfunctionofdimorphicspermimpairsmalefertilityinthesilkworm AT yangxu dysfunctionofdimorphicspermimpairsmalefertilityinthesilkworm AT liuzulian dysfunctionofdimorphicspermimpairsmalefertilityinthesilkworm AT luoxingyu dysfunctionofdimorphicspermimpairsmalefertilityinthesilkworm AT xujun dysfunctionofdimorphicspermimpairsmalefertilityinthesilkworm AT huangyongping dysfunctionofdimorphicspermimpairsmalefertilityinthesilkworm |