Cargando…

The relationship between hyperglycemia and the infection of COVID-19 in diabetic patients: A protocol for systematic review and meta-analysis

BACKGROUND: DM is a common chronic metabolic disease. COVID-19 is an infectious disease infected by enveloped single-stranded RNA coronavirus. Meanwhile, DM is a common comorbidity of SARS-CoV-2 infection. The virus can directly or indirectly damage the pancreatic islets and cause stress hyperglycem...

Descripción completa

Detalles Bibliográficos
Autores principales: Liu, Yan, Yang, Yan, Chen, Yalin, Zhou, Linyue, Xiong, Qian, Xie, Chunguang
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Lippincott Williams & Wilkins 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7478792/
https://www.ncbi.nlm.nih.gov/pubmed/32899010
http://dx.doi.org/10.1097/MD.0000000000021806
_version_ 1783580133343363072
author Liu, Yan
Yang, Yan
Chen, Yalin
Zhou, Linyue
Xiong, Qian
Xie, Chunguang
author_facet Liu, Yan
Yang, Yan
Chen, Yalin
Zhou, Linyue
Xiong, Qian
Xie, Chunguang
author_sort Liu, Yan
collection PubMed
description BACKGROUND: DM is a common chronic metabolic disease. COVID-19 is an infectious disease infected by enveloped single-stranded RNA coronavirus. Meanwhile, DM is a common comorbidity of SARS-CoV-2 infection. The virus can directly or indirectly damage the pancreatic islets and cause stress hyperglycemia by causing cytokine storms, acute inflammatory reactions, binding to the ACE2 receptor, etc. At the same time, hyperglycemia is a risk factor for severe infection and an independent risk factor for mild to severe disease. However, there is no evidence-based medicine to confirm the relationship between hyperglycemia and the infection of COVID-19 in diabetic patients. Therefore, we will conduct a systematic review and meta-analysis to synthesize the existing clinical evidence. METHODS AND ANALYSIS: We will retrieve each database from December 2019 to July 2020. Chinese literature comes from CNKI, Wanfang, VIP, CBM databases. English literature mainly searches Cochrane Library, PubMed, Web of Science, EMBASE. At the same time, we will look for clinical trial registration and gray literature. This study only included clinical randomized controlled trials. The reviewers independently conduct literature selection, data analysis, bias risk assessment, subgroup and sensitivity analysis. The primary outcomes include fasting blood glucose, 2-hour postprandial blood glucose, glycated hemoglobin, fasting insulin, adverse effects, etc. Finally, we will conduct a meta-analysis through Review Manager software version 5.3. RESULTS: The results will be published in peer-reviewed journals. CONCLUSION: This study will explore the relationship between hyperglycemia and COVID-19 infection in diabetic patients. It will provide evidence-based support for clinical regulation of blood glucose and combating the COVID-19 epidemic. REGISTRATION NUMBER: INPLASY202060114
format Online
Article
Text
id pubmed-7478792
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Lippincott Williams & Wilkins
record_format MEDLINE/PubMed
spelling pubmed-74787922020-09-24 The relationship between hyperglycemia and the infection of COVID-19 in diabetic patients: A protocol for systematic review and meta-analysis Liu, Yan Yang, Yan Chen, Yalin Zhou, Linyue Xiong, Qian Xie, Chunguang Medicine (Baltimore) 4900 BACKGROUND: DM is a common chronic metabolic disease. COVID-19 is an infectious disease infected by enveloped single-stranded RNA coronavirus. Meanwhile, DM is a common comorbidity of SARS-CoV-2 infection. The virus can directly or indirectly damage the pancreatic islets and cause stress hyperglycemia by causing cytokine storms, acute inflammatory reactions, binding to the ACE2 receptor, etc. At the same time, hyperglycemia is a risk factor for severe infection and an independent risk factor for mild to severe disease. However, there is no evidence-based medicine to confirm the relationship between hyperglycemia and the infection of COVID-19 in diabetic patients. Therefore, we will conduct a systematic review and meta-analysis to synthesize the existing clinical evidence. METHODS AND ANALYSIS: We will retrieve each database from December 2019 to July 2020. Chinese literature comes from CNKI, Wanfang, VIP, CBM databases. English literature mainly searches Cochrane Library, PubMed, Web of Science, EMBASE. At the same time, we will look for clinical trial registration and gray literature. This study only included clinical randomized controlled trials. The reviewers independently conduct literature selection, data analysis, bias risk assessment, subgroup and sensitivity analysis. The primary outcomes include fasting blood glucose, 2-hour postprandial blood glucose, glycated hemoglobin, fasting insulin, adverse effects, etc. Finally, we will conduct a meta-analysis through Review Manager software version 5.3. RESULTS: The results will be published in peer-reviewed journals. CONCLUSION: This study will explore the relationship between hyperglycemia and COVID-19 infection in diabetic patients. It will provide evidence-based support for clinical regulation of blood glucose and combating the COVID-19 epidemic. REGISTRATION NUMBER: INPLASY202060114 Lippincott Williams & Wilkins 2020-09-04 /pmc/articles/PMC7478792/ /pubmed/32899010 http://dx.doi.org/10.1097/MD.0000000000021806 Text en Copyright © 2020 the Author(s). Published by Wolters Kluwer Health, Inc. http://creativecommons.org/licenses/by/4.0 This is an open access article distributed under the Creative Commons Attribution License 4.0 (CCBY), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. http://creativecommons.org/licenses/by/4.0
spellingShingle 4900
Liu, Yan
Yang, Yan
Chen, Yalin
Zhou, Linyue
Xiong, Qian
Xie, Chunguang
The relationship between hyperglycemia and the infection of COVID-19 in diabetic patients: A protocol for systematic review and meta-analysis
title The relationship between hyperglycemia and the infection of COVID-19 in diabetic patients: A protocol for systematic review and meta-analysis
title_full The relationship between hyperglycemia and the infection of COVID-19 in diabetic patients: A protocol for systematic review and meta-analysis
title_fullStr The relationship between hyperglycemia and the infection of COVID-19 in diabetic patients: A protocol for systematic review and meta-analysis
title_full_unstemmed The relationship between hyperglycemia and the infection of COVID-19 in diabetic patients: A protocol for systematic review and meta-analysis
title_short The relationship between hyperglycemia and the infection of COVID-19 in diabetic patients: A protocol for systematic review and meta-analysis
title_sort relationship between hyperglycemia and the infection of covid-19 in diabetic patients: a protocol for systematic review and meta-analysis
topic 4900
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7478792/
https://www.ncbi.nlm.nih.gov/pubmed/32899010
http://dx.doi.org/10.1097/MD.0000000000021806
work_keys_str_mv AT liuyan therelationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis
AT yangyan therelationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis
AT chenyalin therelationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis
AT zhoulinyue therelationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis
AT xiongqian therelationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis
AT xiechunguang therelationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis
AT liuyan relationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis
AT yangyan relationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis
AT chenyalin relationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis
AT zhoulinyue relationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis
AT xiongqian relationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis
AT xiechunguang relationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis