Cargando…
The relationship between hyperglycemia and the infection of COVID-19 in diabetic patients: A protocol for systematic review and meta-analysis
BACKGROUND: DM is a common chronic metabolic disease. COVID-19 is an infectious disease infected by enveloped single-stranded RNA coronavirus. Meanwhile, DM is a common comorbidity of SARS-CoV-2 infection. The virus can directly or indirectly damage the pancreatic islets and cause stress hyperglycem...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Lippincott Williams & Wilkins
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7478792/ https://www.ncbi.nlm.nih.gov/pubmed/32899010 http://dx.doi.org/10.1097/MD.0000000000021806 |
_version_ | 1783580133343363072 |
---|---|
author | Liu, Yan Yang, Yan Chen, Yalin Zhou, Linyue Xiong, Qian Xie, Chunguang |
author_facet | Liu, Yan Yang, Yan Chen, Yalin Zhou, Linyue Xiong, Qian Xie, Chunguang |
author_sort | Liu, Yan |
collection | PubMed |
description | BACKGROUND: DM is a common chronic metabolic disease. COVID-19 is an infectious disease infected by enveloped single-stranded RNA coronavirus. Meanwhile, DM is a common comorbidity of SARS-CoV-2 infection. The virus can directly or indirectly damage the pancreatic islets and cause stress hyperglycemia by causing cytokine storms, acute inflammatory reactions, binding to the ACE2 receptor, etc. At the same time, hyperglycemia is a risk factor for severe infection and an independent risk factor for mild to severe disease. However, there is no evidence-based medicine to confirm the relationship between hyperglycemia and the infection of COVID-19 in diabetic patients. Therefore, we will conduct a systematic review and meta-analysis to synthesize the existing clinical evidence. METHODS AND ANALYSIS: We will retrieve each database from December 2019 to July 2020. Chinese literature comes from CNKI, Wanfang, VIP, CBM databases. English literature mainly searches Cochrane Library, PubMed, Web of Science, EMBASE. At the same time, we will look for clinical trial registration and gray literature. This study only included clinical randomized controlled trials. The reviewers independently conduct literature selection, data analysis, bias risk assessment, subgroup and sensitivity analysis. The primary outcomes include fasting blood glucose, 2-hour postprandial blood glucose, glycated hemoglobin, fasting insulin, adverse effects, etc. Finally, we will conduct a meta-analysis through Review Manager software version 5.3. RESULTS: The results will be published in peer-reviewed journals. CONCLUSION: This study will explore the relationship between hyperglycemia and COVID-19 infection in diabetic patients. It will provide evidence-based support for clinical regulation of blood glucose and combating the COVID-19 epidemic. REGISTRATION NUMBER: INPLASY202060114 |
format | Online Article Text |
id | pubmed-7478792 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Lippincott Williams & Wilkins |
record_format | MEDLINE/PubMed |
spelling | pubmed-74787922020-09-24 The relationship between hyperglycemia and the infection of COVID-19 in diabetic patients: A protocol for systematic review and meta-analysis Liu, Yan Yang, Yan Chen, Yalin Zhou, Linyue Xiong, Qian Xie, Chunguang Medicine (Baltimore) 4900 BACKGROUND: DM is a common chronic metabolic disease. COVID-19 is an infectious disease infected by enveloped single-stranded RNA coronavirus. Meanwhile, DM is a common comorbidity of SARS-CoV-2 infection. The virus can directly or indirectly damage the pancreatic islets and cause stress hyperglycemia by causing cytokine storms, acute inflammatory reactions, binding to the ACE2 receptor, etc. At the same time, hyperglycemia is a risk factor for severe infection and an independent risk factor for mild to severe disease. However, there is no evidence-based medicine to confirm the relationship between hyperglycemia and the infection of COVID-19 in diabetic patients. Therefore, we will conduct a systematic review and meta-analysis to synthesize the existing clinical evidence. METHODS AND ANALYSIS: We will retrieve each database from December 2019 to July 2020. Chinese literature comes from CNKI, Wanfang, VIP, CBM databases. English literature mainly searches Cochrane Library, PubMed, Web of Science, EMBASE. At the same time, we will look for clinical trial registration and gray literature. This study only included clinical randomized controlled trials. The reviewers independently conduct literature selection, data analysis, bias risk assessment, subgroup and sensitivity analysis. The primary outcomes include fasting blood glucose, 2-hour postprandial blood glucose, glycated hemoglobin, fasting insulin, adverse effects, etc. Finally, we will conduct a meta-analysis through Review Manager software version 5.3. RESULTS: The results will be published in peer-reviewed journals. CONCLUSION: This study will explore the relationship between hyperglycemia and COVID-19 infection in diabetic patients. It will provide evidence-based support for clinical regulation of blood glucose and combating the COVID-19 epidemic. REGISTRATION NUMBER: INPLASY202060114 Lippincott Williams & Wilkins 2020-09-04 /pmc/articles/PMC7478792/ /pubmed/32899010 http://dx.doi.org/10.1097/MD.0000000000021806 Text en Copyright © 2020 the Author(s). Published by Wolters Kluwer Health, Inc. http://creativecommons.org/licenses/by/4.0 This is an open access article distributed under the Creative Commons Attribution License 4.0 (CCBY), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. http://creativecommons.org/licenses/by/4.0 |
spellingShingle | 4900 Liu, Yan Yang, Yan Chen, Yalin Zhou, Linyue Xiong, Qian Xie, Chunguang The relationship between hyperglycemia and the infection of COVID-19 in diabetic patients: A protocol for systematic review and meta-analysis |
title | The relationship between hyperglycemia and the infection of COVID-19 in diabetic patients: A protocol for systematic review and meta-analysis |
title_full | The relationship between hyperglycemia and the infection of COVID-19 in diabetic patients: A protocol for systematic review and meta-analysis |
title_fullStr | The relationship between hyperglycemia and the infection of COVID-19 in diabetic patients: A protocol for systematic review and meta-analysis |
title_full_unstemmed | The relationship between hyperglycemia and the infection of COVID-19 in diabetic patients: A protocol for systematic review and meta-analysis |
title_short | The relationship between hyperglycemia and the infection of COVID-19 in diabetic patients: A protocol for systematic review and meta-analysis |
title_sort | relationship between hyperglycemia and the infection of covid-19 in diabetic patients: a protocol for systematic review and meta-analysis |
topic | 4900 |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7478792/ https://www.ncbi.nlm.nih.gov/pubmed/32899010 http://dx.doi.org/10.1097/MD.0000000000021806 |
work_keys_str_mv | AT liuyan therelationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis AT yangyan therelationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis AT chenyalin therelationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis AT zhoulinyue therelationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis AT xiongqian therelationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis AT xiechunguang therelationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis AT liuyan relationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis AT yangyan relationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis AT chenyalin relationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis AT zhoulinyue relationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis AT xiongqian relationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis AT xiechunguang relationshipbetweenhyperglycemiaandtheinfectionofcovid19indiabeticpatientsaprotocolforsystematicreviewandmetaanalysis |