Cargando…
Conceptualizations of clinical decision-making: a scoping review in geriatric emergency medicine
BACKGROUND: Clinical decision-making (CDM) is an important competency for young doctors especially under complex and uncertain conditions in geriatric emergency medicine (GEM). However, research in this field is characterized by vague conceptualizations of CDM. To evolve and evaluate evidence-based...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7489001/ https://www.ncbi.nlm.nih.gov/pubmed/32928158 http://dx.doi.org/10.1186/s12873-020-00367-2 |
_version_ | 1783581801932914688 |
---|---|
author | Gamborg, Maria Louise Mehlsen, Mimi Paltved, Charlotte Tramm, Gitte Musaeus, Peter |
author_facet | Gamborg, Maria Louise Mehlsen, Mimi Paltved, Charlotte Tramm, Gitte Musaeus, Peter |
author_sort | Gamborg, Maria Louise |
collection | PubMed |
description | BACKGROUND: Clinical decision-making (CDM) is an important competency for young doctors especially under complex and uncertain conditions in geriatric emergency medicine (GEM). However, research in this field is characterized by vague conceptualizations of CDM. To evolve and evaluate evidence-based knowledge of CDM, it is important to identify different definitions and their operationalizations in studies on GEM. OBJECTIVE: A scoping review of empirical articles was conducted to provide an overview of the documented evidence of findings and conceptualizations of CDM in GEM. METHODS: A detailed search for empirical studies focusing on CDM in a GEM setting was conducted in PubMed, ProQuest, Scopus, EMBASE and Web of Science. In total, 52 publications were included in the analysis, utilizing a data extraction sheet, following the PRISMA guidelines. Reported outcomes were summarized. RESULTS: Four themes of operationalization of CDM emerged: CDM as dispositional decisions, CDM as cognition, CDM as a model, and CDM as clinical judgement. Study results and conclusions naturally differed according to how CDM was conceptualized. Thus, frailty-heuristics lead to biases in treatment of geriatric patients and the complexity of this patient group was seen as a challenge for young physicians engaging in CDM. CONCLUSIONS: This scoping review summarizes how different studies in GEM use the term CDM. It provides an analysis of findings in GEM and call for more stringent definitions of CDM in future research, so that it might lead to better clinical practice. |
format | Online Article Text |
id | pubmed-7489001 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-74890012020-09-16 Conceptualizations of clinical decision-making: a scoping review in geriatric emergency medicine Gamborg, Maria Louise Mehlsen, Mimi Paltved, Charlotte Tramm, Gitte Musaeus, Peter BMC Emerg Med Research Article BACKGROUND: Clinical decision-making (CDM) is an important competency for young doctors especially under complex and uncertain conditions in geriatric emergency medicine (GEM). However, research in this field is characterized by vague conceptualizations of CDM. To evolve and evaluate evidence-based knowledge of CDM, it is important to identify different definitions and their operationalizations in studies on GEM. OBJECTIVE: A scoping review of empirical articles was conducted to provide an overview of the documented evidence of findings and conceptualizations of CDM in GEM. METHODS: A detailed search for empirical studies focusing on CDM in a GEM setting was conducted in PubMed, ProQuest, Scopus, EMBASE and Web of Science. In total, 52 publications were included in the analysis, utilizing a data extraction sheet, following the PRISMA guidelines. Reported outcomes were summarized. RESULTS: Four themes of operationalization of CDM emerged: CDM as dispositional decisions, CDM as cognition, CDM as a model, and CDM as clinical judgement. Study results and conclusions naturally differed according to how CDM was conceptualized. Thus, frailty-heuristics lead to biases in treatment of geriatric patients and the complexity of this patient group was seen as a challenge for young physicians engaging in CDM. CONCLUSIONS: This scoping review summarizes how different studies in GEM use the term CDM. It provides an analysis of findings in GEM and call for more stringent definitions of CDM in future research, so that it might lead to better clinical practice. BioMed Central 2020-09-14 /pmc/articles/PMC7489001/ /pubmed/32928158 http://dx.doi.org/10.1186/s12873-020-00367-2 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Article Gamborg, Maria Louise Mehlsen, Mimi Paltved, Charlotte Tramm, Gitte Musaeus, Peter Conceptualizations of clinical decision-making: a scoping review in geriatric emergency medicine |
title | Conceptualizations of clinical decision-making: a scoping review in geriatric emergency medicine |
title_full | Conceptualizations of clinical decision-making: a scoping review in geriatric emergency medicine |
title_fullStr | Conceptualizations of clinical decision-making: a scoping review in geriatric emergency medicine |
title_full_unstemmed | Conceptualizations of clinical decision-making: a scoping review in geriatric emergency medicine |
title_short | Conceptualizations of clinical decision-making: a scoping review in geriatric emergency medicine |
title_sort | conceptualizations of clinical decision-making: a scoping review in geriatric emergency medicine |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7489001/ https://www.ncbi.nlm.nih.gov/pubmed/32928158 http://dx.doi.org/10.1186/s12873-020-00367-2 |
work_keys_str_mv | AT gamborgmarialouise conceptualizationsofclinicaldecisionmakingascopingreviewingeriatricemergencymedicine AT mehlsenmimi conceptualizationsofclinicaldecisionmakingascopingreviewingeriatricemergencymedicine AT paltvedcharlotte conceptualizationsofclinicaldecisionmakingascopingreviewingeriatricemergencymedicine AT trammgitte conceptualizationsofclinicaldecisionmakingascopingreviewingeriatricemergencymedicine AT musaeuspeter conceptualizationsofclinicaldecisionmakingascopingreviewingeriatricemergencymedicine |