Cargando…

Proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: The simple and safe triangle-valve technique

A simple and safe triangle-valve technique (TVT) was applied in proximal gastrectomy (PG) in order to prevent postoperative gastric reflux among patients with adenocarcinoma of the esophagogastric junction (AEG). The clinical outcomes were evaluated in comparison to those of canonical total gastrect...

Descripción completa

Detalles Bibliográficos
Autores principales: Gao, Yongshun, Sun, Jiangang, Chen, Yuheng, Zhang, Yunfei, Chen, Peng, Zong, Liang, Huang, Jingjing, Han, Ji, Chen, Xiaoping
Formato: Online Artículo Texto
Lenguaje:English
Publicado: D.A. Spandidos 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7490797/
https://www.ncbi.nlm.nih.gov/pubmed/32963781
http://dx.doi.org/10.3892/mco.2020.2132
_version_ 1783582097012686848
author Gao, Yongshun
Sun, Jiangang
Chen, Yuheng
Zhang, Yunfei
Chen, Peng
Zong, Liang
Huang, Jingjing
Han, Ji
Chen, Xiaoping
author_facet Gao, Yongshun
Sun, Jiangang
Chen, Yuheng
Zhang, Yunfei
Chen, Peng
Zong, Liang
Huang, Jingjing
Han, Ji
Chen, Xiaoping
author_sort Gao, Yongshun
collection PubMed
description A simple and safe triangle-valve technique (TVT) was applied in proximal gastrectomy (PG) in order to prevent postoperative gastric reflux among patients with adenocarcinoma of the esophagogastric junction (AEG). The clinical outcomes were evaluated in comparison to those of canonical total gastrectomy (TG). This retrospective study of 74 AEG patients compared two surgical procedures, PG-TVT (n=44) and TG (n=30), in terms of surgical outcomes, postoperative complications and nutritional status. The Reflux Disease Questionnaire (RDQ) was used to evaluate reflux esophagitis, and patients with an RDQ score of ≥12 points were diagnosed with gastroesophageal reflux disease (GERD). The mean operative time was significantly shorter in the PG-TVT group (242.6 min) compared with that in the TG group (288.1 min). The overall postoperative complication rate did not differ significantly between the PG-TVT and TG groups. All the patients were followed up for 6 months, and none developed cancer recurrence in distant organs, gastric remnant, or lymph nodes. The GERD incidence was similar between the PG-TVT and TG groups. The mean levels of total protein and albumin within 6 months were significantly higher in the PG-TVT group compared with those in the TG group after adjustingtthe time effect and the interaction of time and surgical methods. The level of total protein significantly increased within 6 months in the PG-TVT group, but decreased in the TG group. Therefore, PG-TVT has several advantages over TG for patients with AEG, including a shorter operative time and better postoperative nutritional status, whereas the incidence of GERD was found to be similar between the two techniques.
format Online
Article
Text
id pubmed-7490797
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher D.A. Spandidos
record_format MEDLINE/PubMed
spelling pubmed-74907972020-09-21 Proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: The simple and safe triangle-valve technique Gao, Yongshun Sun, Jiangang Chen, Yuheng Zhang, Yunfei Chen, Peng Zong, Liang Huang, Jingjing Han, Ji Chen, Xiaoping Mol Clin Oncol Articles A simple and safe triangle-valve technique (TVT) was applied in proximal gastrectomy (PG) in order to prevent postoperative gastric reflux among patients with adenocarcinoma of the esophagogastric junction (AEG). The clinical outcomes were evaluated in comparison to those of canonical total gastrectomy (TG). This retrospective study of 74 AEG patients compared two surgical procedures, PG-TVT (n=44) and TG (n=30), in terms of surgical outcomes, postoperative complications and nutritional status. The Reflux Disease Questionnaire (RDQ) was used to evaluate reflux esophagitis, and patients with an RDQ score of ≥12 points were diagnosed with gastroesophageal reflux disease (GERD). The mean operative time was significantly shorter in the PG-TVT group (242.6 min) compared with that in the TG group (288.1 min). The overall postoperative complication rate did not differ significantly between the PG-TVT and TG groups. All the patients were followed up for 6 months, and none developed cancer recurrence in distant organs, gastric remnant, or lymph nodes. The GERD incidence was similar between the PG-TVT and TG groups. The mean levels of total protein and albumin within 6 months were significantly higher in the PG-TVT group compared with those in the TG group after adjustingtthe time effect and the interaction of time and surgical methods. The level of total protein significantly increased within 6 months in the PG-TVT group, but decreased in the TG group. Therefore, PG-TVT has several advantages over TG for patients with AEG, including a shorter operative time and better postoperative nutritional status, whereas the incidence of GERD was found to be similar between the two techniques. D.A. Spandidos 2020-11 2020-09-07 /pmc/articles/PMC7490797/ /pubmed/32963781 http://dx.doi.org/10.3892/mco.2020.2132 Text en Copyright: © Gao et al. This is an open access article distributed under the terms of the Creative Commons Attribution-NonCommercial-NoDerivs License (https://creativecommons.org/licenses/by-nc-nd/4.0/) , which permits use and distribution in any medium, provided the original work is properly cited, the use is non-commercial and no modifications or adaptations are made.
spellingShingle Articles
Gao, Yongshun
Sun, Jiangang
Chen, Yuheng
Zhang, Yunfei
Chen, Peng
Zong, Liang
Huang, Jingjing
Han, Ji
Chen, Xiaoping
Proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: The simple and safe triangle-valve technique
title Proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: The simple and safe triangle-valve technique
title_full Proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: The simple and safe triangle-valve technique
title_fullStr Proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: The simple and safe triangle-valve technique
title_full_unstemmed Proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: The simple and safe triangle-valve technique
title_short Proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: The simple and safe triangle-valve technique
title_sort proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: the simple and safe triangle-valve technique
topic Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7490797/
https://www.ncbi.nlm.nih.gov/pubmed/32963781
http://dx.doi.org/10.3892/mco.2020.2132
work_keys_str_mv AT gaoyongshun proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique
AT sunjiangang proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique
AT chenyuheng proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique
AT zhangyunfei proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique
AT chenpeng proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique
AT zongliang proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique
AT huangjingjing proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique
AT hanji proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique
AT chenxiaoping proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique