Cargando…
Proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: The simple and safe triangle-valve technique
A simple and safe triangle-valve technique (TVT) was applied in proximal gastrectomy (PG) in order to prevent postoperative gastric reflux among patients with adenocarcinoma of the esophagogastric junction (AEG). The clinical outcomes were evaluated in comparison to those of canonical total gastrect...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
D.A. Spandidos
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7490797/ https://www.ncbi.nlm.nih.gov/pubmed/32963781 http://dx.doi.org/10.3892/mco.2020.2132 |
_version_ | 1783582097012686848 |
---|---|
author | Gao, Yongshun Sun, Jiangang Chen, Yuheng Zhang, Yunfei Chen, Peng Zong, Liang Huang, Jingjing Han, Ji Chen, Xiaoping |
author_facet | Gao, Yongshun Sun, Jiangang Chen, Yuheng Zhang, Yunfei Chen, Peng Zong, Liang Huang, Jingjing Han, Ji Chen, Xiaoping |
author_sort | Gao, Yongshun |
collection | PubMed |
description | A simple and safe triangle-valve technique (TVT) was applied in proximal gastrectomy (PG) in order to prevent postoperative gastric reflux among patients with adenocarcinoma of the esophagogastric junction (AEG). The clinical outcomes were evaluated in comparison to those of canonical total gastrectomy (TG). This retrospective study of 74 AEG patients compared two surgical procedures, PG-TVT (n=44) and TG (n=30), in terms of surgical outcomes, postoperative complications and nutritional status. The Reflux Disease Questionnaire (RDQ) was used to evaluate reflux esophagitis, and patients with an RDQ score of ≥12 points were diagnosed with gastroesophageal reflux disease (GERD). The mean operative time was significantly shorter in the PG-TVT group (242.6 min) compared with that in the TG group (288.1 min). The overall postoperative complication rate did not differ significantly between the PG-TVT and TG groups. All the patients were followed up for 6 months, and none developed cancer recurrence in distant organs, gastric remnant, or lymph nodes. The GERD incidence was similar between the PG-TVT and TG groups. The mean levels of total protein and albumin within 6 months were significantly higher in the PG-TVT group compared with those in the TG group after adjustingtthe time effect and the interaction of time and surgical methods. The level of total protein significantly increased within 6 months in the PG-TVT group, but decreased in the TG group. Therefore, PG-TVT has several advantages over TG for patients with AEG, including a shorter operative time and better postoperative nutritional status, whereas the incidence of GERD was found to be similar between the two techniques. |
format | Online Article Text |
id | pubmed-7490797 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | D.A. Spandidos |
record_format | MEDLINE/PubMed |
spelling | pubmed-74907972020-09-21 Proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: The simple and safe triangle-valve technique Gao, Yongshun Sun, Jiangang Chen, Yuheng Zhang, Yunfei Chen, Peng Zong, Liang Huang, Jingjing Han, Ji Chen, Xiaoping Mol Clin Oncol Articles A simple and safe triangle-valve technique (TVT) was applied in proximal gastrectomy (PG) in order to prevent postoperative gastric reflux among patients with adenocarcinoma of the esophagogastric junction (AEG). The clinical outcomes were evaluated in comparison to those of canonical total gastrectomy (TG). This retrospective study of 74 AEG patients compared two surgical procedures, PG-TVT (n=44) and TG (n=30), in terms of surgical outcomes, postoperative complications and nutritional status. The Reflux Disease Questionnaire (RDQ) was used to evaluate reflux esophagitis, and patients with an RDQ score of ≥12 points were diagnosed with gastroesophageal reflux disease (GERD). The mean operative time was significantly shorter in the PG-TVT group (242.6 min) compared with that in the TG group (288.1 min). The overall postoperative complication rate did not differ significantly between the PG-TVT and TG groups. All the patients were followed up for 6 months, and none developed cancer recurrence in distant organs, gastric remnant, or lymph nodes. The GERD incidence was similar between the PG-TVT and TG groups. The mean levels of total protein and albumin within 6 months were significantly higher in the PG-TVT group compared with those in the TG group after adjustingtthe time effect and the interaction of time and surgical methods. The level of total protein significantly increased within 6 months in the PG-TVT group, but decreased in the TG group. Therefore, PG-TVT has several advantages over TG for patients with AEG, including a shorter operative time and better postoperative nutritional status, whereas the incidence of GERD was found to be similar between the two techniques. D.A. Spandidos 2020-11 2020-09-07 /pmc/articles/PMC7490797/ /pubmed/32963781 http://dx.doi.org/10.3892/mco.2020.2132 Text en Copyright: © Gao et al. This is an open access article distributed under the terms of the Creative Commons Attribution-NonCommercial-NoDerivs License (https://creativecommons.org/licenses/by-nc-nd/4.0/) , which permits use and distribution in any medium, provided the original work is properly cited, the use is non-commercial and no modifications or adaptations are made. |
spellingShingle | Articles Gao, Yongshun Sun, Jiangang Chen, Yuheng Zhang, Yunfei Chen, Peng Zong, Liang Huang, Jingjing Han, Ji Chen, Xiaoping Proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: The simple and safe triangle-valve technique |
title | Proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: The simple and safe triangle-valve technique |
title_full | Proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: The simple and safe triangle-valve technique |
title_fullStr | Proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: The simple and safe triangle-valve technique |
title_full_unstemmed | Proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: The simple and safe triangle-valve technique |
title_short | Proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: The simple and safe triangle-valve technique |
title_sort | proximal gastrectomy with anti-reflux anastomosis for patients with adenocarcinoma of the esophagogastric junction: the simple and safe triangle-valve technique |
topic | Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7490797/ https://www.ncbi.nlm.nih.gov/pubmed/32963781 http://dx.doi.org/10.3892/mco.2020.2132 |
work_keys_str_mv | AT gaoyongshun proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique AT sunjiangang proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique AT chenyuheng proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique AT zhangyunfei proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique AT chenpeng proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique AT zongliang proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique AT huangjingjing proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique AT hanji proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique AT chenxiaoping proximalgastrectomywithantirefluxanastomosisforpatientswithadenocarcinomaoftheesophagogastricjunctionthesimpleandsafetrianglevalvetechnique |