Comment on: “The treatment of sarcoptic mange in wildlife: a systematic review”

This letter comments on the article “The treatment of sarcoptic mange in wildlife: a systematic review” published in Parasites & Vectors 2019, 12:99, and discusses the limitations in the use of endectocides for scabies control in free-ranging wildlife. The ecological impact and drug resistance t...

Descripción completa

Detalles Bibliográficos
Autores principales: Moroni, Barbara, Valldeperes, Marta, Serrano, Emmanuel, López-Olvera, Jorge Ramón, Lavín, Santiago, Rossi, Luca
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2020
Materias:
Letter to the Editor
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7491160/
https://www.ncbi.nlm.nih.gov/pubmed/32933573
http://dx.doi.org/10.1186/s13071-020-04347-0
_version_ 1783582165189001216
author Moroni, Barbara
Valldeperes, Marta
Serrano, Emmanuel
López-Olvera, Jorge Ramón
Lavín, Santiago
Rossi, Luca
author_facet Moroni, Barbara
Valldeperes, Marta
Serrano, Emmanuel
López-Olvera, Jorge Ramón
Lavín, Santiago
Rossi, Luca
author_sort Moroni, Barbara
collection PubMed
description This letter comments on the article “The treatment of sarcoptic mange in wildlife: a systematic review” published in Parasites & Vectors 2019, 12:99, and discusses the limitations in the use of endectocides for scabies control in free-ranging wildlife. The ecological impact and drug resistance to ivermectin are also discussed. In our view, scabies control in free-ranging wildlife should be based preferably on population management measures, and whether to apply individual treatments to free-ranging populations should be considered very carefully and avoided where not absolutely warranted.
format Online
Article
Text
id pubmed-7491160
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-74911602020-09-16 Comment on: “The treatment of sarcoptic mange in wildlife: a systematic review” Moroni, Barbara Valldeperes, Marta Serrano, Emmanuel López-Olvera, Jorge Ramón Lavín, Santiago Rossi, Luca Parasit Vectors Letter to the Editor This letter comments on the article “The treatment of sarcoptic mange in wildlife: a systematic review” published in Parasites & Vectors 2019, 12:99, and discusses the limitations in the use of endectocides for scabies control in free-ranging wildlife. The ecological impact and drug resistance to ivermectin are also discussed. In our view, scabies control in free-ranging wildlife should be based preferably on population management measures, and whether to apply individual treatments to free-ranging populations should be considered very carefully and avoided where not absolutely warranted. BioMed Central 2020-09-15 /pmc/articles/PMC7491160/ /pubmed/32933573 http://dx.doi.org/10.1186/s13071-020-04347-0 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Letter to the Editor
Moroni, Barbara
Valldeperes, Marta
Serrano, Emmanuel
López-Olvera, Jorge Ramón
Lavín, Santiago
Rossi, Luca
Comment on: “The treatment of sarcoptic mange in wildlife: a systematic review”
title Comment on: “The treatment of sarcoptic mange in wildlife: a systematic review”
title_full Comment on: “The treatment of sarcoptic mange in wildlife: a systematic review”
title_fullStr Comment on: “The treatment of sarcoptic mange in wildlife: a systematic review”
title_full_unstemmed Comment on: “The treatment of sarcoptic mange in wildlife: a systematic review”
title_short Comment on: “The treatment of sarcoptic mange in wildlife: a systematic review”
title_sort comment on: “the treatment of sarcoptic mange in wildlife: a systematic review”
topic Letter to the Editor
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7491160/
https://www.ncbi.nlm.nih.gov/pubmed/32933573
http://dx.doi.org/10.1186/s13071-020-04347-0
work_keys_str_mv AT moronibarbara commentonthetreatmentofsarcopticmangeinwildlifeasystematicreview
AT valldeperesmarta commentonthetreatmentofsarcopticmangeinwildlifeasystematicreview
AT serranoemmanuel commentonthetreatmentofsarcopticmangeinwildlifeasystematicreview
AT lopezolverajorgeramon commentonthetreatmentofsarcopticmangeinwildlifeasystematicreview
AT lavinsantiago commentonthetreatmentofsarcopticmangeinwildlifeasystematicreview
AT rossiluca commentonthetreatmentofsarcopticmangeinwildlifeasystematicreview

Ejemplares similares