Cargando…

Development and validation of a person-centered abortion scale: the experiences of care in private facilities in Kenya

BACKGROUND: There is a need for a standardized way to measure person-centered care for abortion. This study developed and validated a measure of person-centered abortion care. METHODS: Items for person-centered abortion care were developed from literature reviews, expert review, and cognitive interv...

Descripción completa

Detalles Bibliográficos
Autores principales: Sudhinaraset, May, Landrian, Amanda, Afulani, Patience A., Phillips, Beth, Diamond-Smith, Nadia, Cotter, Sun
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7501655/
https://www.ncbi.nlm.nih.gov/pubmed/32950052
http://dx.doi.org/10.1186/s12905-020-01071-w
_version_ 1783584073175793664
author Sudhinaraset, May
Landrian, Amanda
Afulani, Patience A.
Phillips, Beth
Diamond-Smith, Nadia
Cotter, Sun
author_facet Sudhinaraset, May
Landrian, Amanda
Afulani, Patience A.
Phillips, Beth
Diamond-Smith, Nadia
Cotter, Sun
author_sort Sudhinaraset, May
collection PubMed
description BACKGROUND: There is a need for a standardized way to measure person-centered care for abortion. This study developed and validated a measure of person-centered abortion care. METHODS: Items for person-centered abortion care were developed from literature reviews, expert review, and cognitive interviews, and administered with 371 women who received a safe abortion service from private health clinics in Nairobi, Kenya. Exploratory factor analyses were performed and stratified by surgical abortion procedures and medication abortion. Bivariate linear regressions assessed for criterion validity. RESULTS: We developed a 24-item unifying scale for person-centered abortion care including two sub-scales. The two sub-scales identified were: 1) Respectful and Supportive Care (14 items for medication abortion, 15 items for surgical abortion); and 2) Communication and Autonomy (9 items for both medication and surgical abortion). The person-centered abortion care scale had high content, construct, criterion validity, and reliability. CONCLUSIONS: This validated scale will facilitate measurement and further research to better understand women’s experiences during abortion care and to improve the quality of women’s overall reproductive health experiences to improve health outcomes.
format Online
Article
Text
id pubmed-7501655
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-75016552020-09-22 Development and validation of a person-centered abortion scale: the experiences of care in private facilities in Kenya Sudhinaraset, May Landrian, Amanda Afulani, Patience A. Phillips, Beth Diamond-Smith, Nadia Cotter, Sun BMC Womens Health Research Article BACKGROUND: There is a need for a standardized way to measure person-centered care for abortion. This study developed and validated a measure of person-centered abortion care. METHODS: Items for person-centered abortion care were developed from literature reviews, expert review, and cognitive interviews, and administered with 371 women who received a safe abortion service from private health clinics in Nairobi, Kenya. Exploratory factor analyses were performed and stratified by surgical abortion procedures and medication abortion. Bivariate linear regressions assessed for criterion validity. RESULTS: We developed a 24-item unifying scale for person-centered abortion care including two sub-scales. The two sub-scales identified were: 1) Respectful and Supportive Care (14 items for medication abortion, 15 items for surgical abortion); and 2) Communication and Autonomy (9 items for both medication and surgical abortion). The person-centered abortion care scale had high content, construct, criterion validity, and reliability. CONCLUSIONS: This validated scale will facilitate measurement and further research to better understand women’s experiences during abortion care and to improve the quality of women’s overall reproductive health experiences to improve health outcomes. BioMed Central 2020-09-19 /pmc/articles/PMC7501655/ /pubmed/32950052 http://dx.doi.org/10.1186/s12905-020-01071-w Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
Sudhinaraset, May
Landrian, Amanda
Afulani, Patience A.
Phillips, Beth
Diamond-Smith, Nadia
Cotter, Sun
Development and validation of a person-centered abortion scale: the experiences of care in private facilities in Kenya
title Development and validation of a person-centered abortion scale: the experiences of care in private facilities in Kenya
title_full Development and validation of a person-centered abortion scale: the experiences of care in private facilities in Kenya
title_fullStr Development and validation of a person-centered abortion scale: the experiences of care in private facilities in Kenya
title_full_unstemmed Development and validation of a person-centered abortion scale: the experiences of care in private facilities in Kenya
title_short Development and validation of a person-centered abortion scale: the experiences of care in private facilities in Kenya
title_sort development and validation of a person-centered abortion scale: the experiences of care in private facilities in kenya
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7501655/
https://www.ncbi.nlm.nih.gov/pubmed/32950052
http://dx.doi.org/10.1186/s12905-020-01071-w
work_keys_str_mv AT sudhinarasetmay developmentandvalidationofapersoncenteredabortionscaletheexperiencesofcareinprivatefacilitiesinkenya
AT landrianamanda developmentandvalidationofapersoncenteredabortionscaletheexperiencesofcareinprivatefacilitiesinkenya
AT afulanipatiencea developmentandvalidationofapersoncenteredabortionscaletheexperiencesofcareinprivatefacilitiesinkenya
AT phillipsbeth developmentandvalidationofapersoncenteredabortionscaletheexperiencesofcareinprivatefacilitiesinkenya
AT diamondsmithnadia developmentandvalidationofapersoncenteredabortionscaletheexperiencesofcareinprivatefacilitiesinkenya
AT cottersun developmentandvalidationofapersoncenteredabortionscaletheexperiencesofcareinprivatefacilitiesinkenya