Cargando…

Systematic summarization of the expression profiles and prognostic roles of the dishevelled gene family in hepatocellular carcinoma

BACKGROUND: Dishevelled (DVL) family members are crucial to Wnt‐induced signaling transduction, and their expression is highly correlated with the progression of multiple malignant cancers. However, the expression profiles and exact prognostic values of DVLs in hepatocellular carcinoma (HCC) have no...

Descripción completa

Detalles Bibliográficos
Autores principales: Mei, Jie, Yang, Xuejing, Xia, Dandan, Zhou, Weijian, Gu, Dingyi, Wang, Huiyu, Liu, Chaoying
Formato: Online Artículo Texto
Lenguaje:English
Publicado: John Wiley and Sons Inc. 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7507050/
https://www.ncbi.nlm.nih.gov/pubmed/32588988
http://dx.doi.org/10.1002/mgg3.1384
_version_ 1783585152569442304
author Mei, Jie
Yang, Xuejing
Xia, Dandan
Zhou, Weijian
Gu, Dingyi
Wang, Huiyu
Liu, Chaoying
author_facet Mei, Jie
Yang, Xuejing
Xia, Dandan
Zhou, Weijian
Gu, Dingyi
Wang, Huiyu
Liu, Chaoying
author_sort Mei, Jie
collection PubMed
description BACKGROUND: Dishevelled (DVL) family members are crucial to Wnt‐induced signaling transduction, and their expression is highly correlated with the progression of multiple malignant cancers. However, the expression profiles and exact prognostic values of DVLs in hepatocellular carcinoma (HCC) have not been explored until now. METHODS: The expression of DVL isoforms was assessed using the Oncomine, HCCDB and UALCAN databases. The prognostic roles of DVLs were further evaluated using the GEPIA database. The relationship between the expression of DVLs and immune infiltration of HCC was investigated using the Timer and ImmuCellAI tools. Furthermore, protein–protein interaction (PPI) networks were built and enrichment analyses were conducted. RESULTS: We found that the expression levels of DVL2 (OMIM accession number: 602151) and DVL3 (OMIM accession number: 601368) were upregulated in HCC tissues as revealed by the Oncomine and HCCDB databases. Additionally, the expression of DVLs tended to be associated with advanced clinical features in the UALCAN database. Prognostic analysis revealed that the expression levels of DVL1 (OMIM accession number: 601365) and DVL3 were remarkably associated with a poor prognosis in HCC patients. The results also revealed that the DVL expression level was correlated with the infiltration levels of multiple immune cells. By constructing the PPI network and enrichment analyses, the DVL1‐3 gene was identified to interact with 20 key genes and participate in several pathways. CONCLUSION: In summary, DVL2 and DVL3 are highly expressed in HCC, and DVL1 and DVL3 are related to a poor prognosis, which might be used as candidate targets for targeted therapy and reliable prognostic biomarkers in HCC.
format Online
Article
Text
id pubmed-7507050
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher John Wiley and Sons Inc.
record_format MEDLINE/PubMed
spelling pubmed-75070502020-09-28 Systematic summarization of the expression profiles and prognostic roles of the dishevelled gene family in hepatocellular carcinoma Mei, Jie Yang, Xuejing Xia, Dandan Zhou, Weijian Gu, Dingyi Wang, Huiyu Liu, Chaoying Mol Genet Genomic Med Original Articles BACKGROUND: Dishevelled (DVL) family members are crucial to Wnt‐induced signaling transduction, and their expression is highly correlated with the progression of multiple malignant cancers. However, the expression profiles and exact prognostic values of DVLs in hepatocellular carcinoma (HCC) have not been explored until now. METHODS: The expression of DVL isoforms was assessed using the Oncomine, HCCDB and UALCAN databases. The prognostic roles of DVLs were further evaluated using the GEPIA database. The relationship between the expression of DVLs and immune infiltration of HCC was investigated using the Timer and ImmuCellAI tools. Furthermore, protein–protein interaction (PPI) networks were built and enrichment analyses were conducted. RESULTS: We found that the expression levels of DVL2 (OMIM accession number: 602151) and DVL3 (OMIM accession number: 601368) were upregulated in HCC tissues as revealed by the Oncomine and HCCDB databases. Additionally, the expression of DVLs tended to be associated with advanced clinical features in the UALCAN database. Prognostic analysis revealed that the expression levels of DVL1 (OMIM accession number: 601365) and DVL3 were remarkably associated with a poor prognosis in HCC patients. The results also revealed that the DVL expression level was correlated with the infiltration levels of multiple immune cells. By constructing the PPI network and enrichment analyses, the DVL1‐3 gene was identified to interact with 20 key genes and participate in several pathways. CONCLUSION: In summary, DVL2 and DVL3 are highly expressed in HCC, and DVL1 and DVL3 are related to a poor prognosis, which might be used as candidate targets for targeted therapy and reliable prognostic biomarkers in HCC. John Wiley and Sons Inc. 2020-06-26 /pmc/articles/PMC7507050/ /pubmed/32588988 http://dx.doi.org/10.1002/mgg3.1384 Text en © 2020 The Authors. Molecular Genetics & Genomic Medicine published by Wiley Periodicals LLC. This is an open access article under the terms of the http://creativecommons.org/licenses/by-nc/4.0/ License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited and is not used for commercial purposes.
spellingShingle Original Articles
Mei, Jie
Yang, Xuejing
Xia, Dandan
Zhou, Weijian
Gu, Dingyi
Wang, Huiyu
Liu, Chaoying
Systematic summarization of the expression profiles and prognostic roles of the dishevelled gene family in hepatocellular carcinoma
title Systematic summarization of the expression profiles and prognostic roles of the dishevelled gene family in hepatocellular carcinoma
title_full Systematic summarization of the expression profiles and prognostic roles of the dishevelled gene family in hepatocellular carcinoma
title_fullStr Systematic summarization of the expression profiles and prognostic roles of the dishevelled gene family in hepatocellular carcinoma
title_full_unstemmed Systematic summarization of the expression profiles and prognostic roles of the dishevelled gene family in hepatocellular carcinoma
title_short Systematic summarization of the expression profiles and prognostic roles of the dishevelled gene family in hepatocellular carcinoma
title_sort systematic summarization of the expression profiles and prognostic roles of the dishevelled gene family in hepatocellular carcinoma
topic Original Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7507050/
https://www.ncbi.nlm.nih.gov/pubmed/32588988
http://dx.doi.org/10.1002/mgg3.1384
work_keys_str_mv AT meijie systematicsummarizationoftheexpressionprofilesandprognosticrolesofthedishevelledgenefamilyinhepatocellularcarcinoma
AT yangxuejing systematicsummarizationoftheexpressionprofilesandprognosticrolesofthedishevelledgenefamilyinhepatocellularcarcinoma
AT xiadandan systematicsummarizationoftheexpressionprofilesandprognosticrolesofthedishevelledgenefamilyinhepatocellularcarcinoma
AT zhouweijian systematicsummarizationoftheexpressionprofilesandprognosticrolesofthedishevelledgenefamilyinhepatocellularcarcinoma
AT gudingyi systematicsummarizationoftheexpressionprofilesandprognosticrolesofthedishevelledgenefamilyinhepatocellularcarcinoma
AT wanghuiyu systematicsummarizationoftheexpressionprofilesandprognosticrolesofthedishevelledgenefamilyinhepatocellularcarcinoma
AT liuchaoying systematicsummarizationoftheexpressionprofilesandprognosticrolesofthedishevelledgenefamilyinhepatocellularcarcinoma