Cargando…
Storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia
BACKGROUND: Delayed Post Hypoxic Leukoencephalopathy (DPHL) is a syndrome that occurs after hypoxia, and can present with a variety of neuropsychiatric symptoms, including catatonia and paroxysmal sympathetic hyperactivity (PSH). The gold standard for the treatment of catatonia is electroconvulsive...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7523250/ https://www.ncbi.nlm.nih.gov/pubmed/32993556 http://dx.doi.org/10.1186/s12888-020-02878-5 |
_version_ | 1783588350136942592 |
---|---|
author | Hamlin, Dallas Wolfgang Hussain, Nuzhat Pathare, Aum |
author_facet | Hamlin, Dallas Wolfgang Hussain, Nuzhat Pathare, Aum |
author_sort | Hamlin, Dallas Wolfgang |
collection | PubMed |
description | BACKGROUND: Delayed Post Hypoxic Leukoencephalopathy (DPHL) is a syndrome that occurs after hypoxia, and can present with a variety of neuropsychiatric symptoms, including catatonia and paroxysmal sympathetic hyperactivity (PSH). The gold standard for the treatment of catatonia is electroconvulsive therapy (ECT). However, ECT can exacerbate the paroxysms of sympathetic hyperactivity and complicate recovery from DPHL. The treatment of PSH is not well established. CASE PRESENTATION: We present a case of a patient with multiple opiate overdoses who presented with altered mental status. He was diagnosed with catatonia and subsequently treated with ECT. His clinical condition worsened, and a revised diagnosis of PSH was established. The patient’s condition improved with medical management. CONCLUSION: This case highlights the need to distinguish between these two related symptom clusters, as the incidence of DPHL and opioid overdose related neuropsychiatric problems increase. This distinction can greatly influence the course of treatment, and the need to consider alternative treatments. |
format | Online Article Text |
id | pubmed-7523250 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-75232502020-09-29 Storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia Hamlin, Dallas Wolfgang Hussain, Nuzhat Pathare, Aum BMC Psychiatry Case Report BACKGROUND: Delayed Post Hypoxic Leukoencephalopathy (DPHL) is a syndrome that occurs after hypoxia, and can present with a variety of neuropsychiatric symptoms, including catatonia and paroxysmal sympathetic hyperactivity (PSH). The gold standard for the treatment of catatonia is electroconvulsive therapy (ECT). However, ECT can exacerbate the paroxysms of sympathetic hyperactivity and complicate recovery from DPHL. The treatment of PSH is not well established. CASE PRESENTATION: We present a case of a patient with multiple opiate overdoses who presented with altered mental status. He was diagnosed with catatonia and subsequently treated with ECT. His clinical condition worsened, and a revised diagnosis of PSH was established. The patient’s condition improved with medical management. CONCLUSION: This case highlights the need to distinguish between these two related symptom clusters, as the incidence of DPHL and opioid overdose related neuropsychiatric problems increase. This distinction can greatly influence the course of treatment, and the need to consider alternative treatments. BioMed Central 2020-09-29 /pmc/articles/PMC7523250/ /pubmed/32993556 http://dx.doi.org/10.1186/s12888-020-02878-5 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Case Report Hamlin, Dallas Wolfgang Hussain, Nuzhat Pathare, Aum Storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia |
title | Storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia |
title_full | Storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia |
title_fullStr | Storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia |
title_full_unstemmed | Storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia |
title_short | Storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia |
title_sort | storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7523250/ https://www.ncbi.nlm.nih.gov/pubmed/32993556 http://dx.doi.org/10.1186/s12888-020-02878-5 |
work_keys_str_mv | AT hamlindallaswolfgang stormsandsilenceacasereportofcatatoniaandparoxysmalsympathetichyperactivityfollowingcerebralhypoxia AT hussainnuzhat stormsandsilenceacasereportofcatatoniaandparoxysmalsympathetichyperactivityfollowingcerebralhypoxia AT pathareaum stormsandsilenceacasereportofcatatoniaandparoxysmalsympathetichyperactivityfollowingcerebralhypoxia |