Cargando…

Storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia

BACKGROUND: Delayed Post Hypoxic Leukoencephalopathy (DPHL) is a syndrome that occurs after hypoxia, and can present with a variety of neuropsychiatric symptoms, including catatonia and paroxysmal sympathetic hyperactivity (PSH). The gold standard for the treatment of catatonia is electroconvulsive...

Descripción completa

Detalles Bibliográficos
Autores principales: Hamlin, Dallas Wolfgang, Hussain, Nuzhat, Pathare, Aum
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7523250/
https://www.ncbi.nlm.nih.gov/pubmed/32993556
http://dx.doi.org/10.1186/s12888-020-02878-5
_version_ 1783588350136942592
author Hamlin, Dallas Wolfgang
Hussain, Nuzhat
Pathare, Aum
author_facet Hamlin, Dallas Wolfgang
Hussain, Nuzhat
Pathare, Aum
author_sort Hamlin, Dallas Wolfgang
collection PubMed
description BACKGROUND: Delayed Post Hypoxic Leukoencephalopathy (DPHL) is a syndrome that occurs after hypoxia, and can present with a variety of neuropsychiatric symptoms, including catatonia and paroxysmal sympathetic hyperactivity (PSH). The gold standard for the treatment of catatonia is electroconvulsive therapy (ECT). However, ECT can exacerbate the paroxysms of sympathetic hyperactivity and complicate recovery from DPHL. The treatment of PSH is not well established. CASE PRESENTATION: We present a case of a patient with multiple opiate overdoses who presented with altered mental status. He was diagnosed with catatonia and subsequently treated with ECT. His clinical condition worsened, and a revised diagnosis of PSH was established. The patient’s condition improved with medical management. CONCLUSION: This case highlights the need to distinguish between these two related symptom clusters, as the incidence of DPHL and opioid overdose related neuropsychiatric problems increase. This distinction can greatly influence the course of treatment, and the need to consider alternative treatments.
format Online
Article
Text
id pubmed-7523250
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-75232502020-09-29 Storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia Hamlin, Dallas Wolfgang Hussain, Nuzhat Pathare, Aum BMC Psychiatry Case Report BACKGROUND: Delayed Post Hypoxic Leukoencephalopathy (DPHL) is a syndrome that occurs after hypoxia, and can present with a variety of neuropsychiatric symptoms, including catatonia and paroxysmal sympathetic hyperactivity (PSH). The gold standard for the treatment of catatonia is electroconvulsive therapy (ECT). However, ECT can exacerbate the paroxysms of sympathetic hyperactivity and complicate recovery from DPHL. The treatment of PSH is not well established. CASE PRESENTATION: We present a case of a patient with multiple opiate overdoses who presented with altered mental status. He was diagnosed with catatonia and subsequently treated with ECT. His clinical condition worsened, and a revised diagnosis of PSH was established. The patient’s condition improved with medical management. CONCLUSION: This case highlights the need to distinguish between these two related symptom clusters, as the incidence of DPHL and opioid overdose related neuropsychiatric problems increase. This distinction can greatly influence the course of treatment, and the need to consider alternative treatments. BioMed Central 2020-09-29 /pmc/articles/PMC7523250/ /pubmed/32993556 http://dx.doi.org/10.1186/s12888-020-02878-5 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Case Report
Hamlin, Dallas Wolfgang
Hussain, Nuzhat
Pathare, Aum
Storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia
title Storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia
title_full Storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia
title_fullStr Storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia
title_full_unstemmed Storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia
title_short Storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia
title_sort storms and silence: a case report of catatonia and paroxysmal sympathetic hyperactivity following cerebral hypoxia
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7523250/
https://www.ncbi.nlm.nih.gov/pubmed/32993556
http://dx.doi.org/10.1186/s12888-020-02878-5
work_keys_str_mv AT hamlindallaswolfgang stormsandsilenceacasereportofcatatoniaandparoxysmalsympathetichyperactivityfollowingcerebralhypoxia
AT hussainnuzhat stormsandsilenceacasereportofcatatoniaandparoxysmalsympathetichyperactivityfollowingcerebralhypoxia
AT pathareaum stormsandsilenceacasereportofcatatoniaandparoxysmalsympathetichyperactivityfollowingcerebralhypoxia