Cargando…
Wnt Pathway: An Emerging Player in Vascular and Traumatic Mediated Brain Injuries
The Wnt pathway, which comprises the canonical and non-canonical pathways, is an evolutionarily conserved mechanism that regulates crucial biological aspects throughout the development and adulthood. Emergence and patterning of the nervous and vascular systems are intimately coordinated, a process i...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7530281/ https://www.ncbi.nlm.nih.gov/pubmed/33071819 http://dx.doi.org/10.3389/fphys.2020.565667 |
_version_ | 1783589539706568704 |
---|---|
author | Menet, Romain Lecordier, Sarah ElAli, Ayman |
author_facet | Menet, Romain Lecordier, Sarah ElAli, Ayman |
author_sort | Menet, Romain |
collection | PubMed |
description | The Wnt pathway, which comprises the canonical and non-canonical pathways, is an evolutionarily conserved mechanism that regulates crucial biological aspects throughout the development and adulthood. Emergence and patterning of the nervous and vascular systems are intimately coordinated, a process in which Wnt pathway plays particularly important roles. In the brain, Wnt ligands activate a cell-specific surface receptor complex to induce intracellular signaling cascades regulating neurogenesis, synaptogenesis, neuronal plasticity, synaptic plasticity, angiogenesis, vascular stabilization, and inflammation. The Wnt pathway is tightly regulated in the adult brain to maintain neurovascular functions. Historically, research in neuroscience has emphasized essentially on investigating the pathway in neurodegenerative disorders. Nonetheless, emerging findings have demonstrated that the pathway is deregulated in vascular- and traumatic-mediated brain injuries. These findings are suggesting that the pathway constitutes a promising target for the development of novel therapeutic protective and restorative interventions. Yet, targeting a complex multifunctional signal transduction pathway remains a major challenge. The review aims to summarize the current knowledge regarding the implication of Wnt pathway in the pathobiology of ischemic and hemorrhagic stroke, as well as traumatic brain injury (TBI). Furthermore, the review will present the strategies used so far to manipulate the pathway for therapeutic purposes as to highlight potential future directions. |
format | Online Article Text |
id | pubmed-7530281 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-75302812020-10-17 Wnt Pathway: An Emerging Player in Vascular and Traumatic Mediated Brain Injuries Menet, Romain Lecordier, Sarah ElAli, Ayman Front Physiol Physiology The Wnt pathway, which comprises the canonical and non-canonical pathways, is an evolutionarily conserved mechanism that regulates crucial biological aspects throughout the development and adulthood. Emergence and patterning of the nervous and vascular systems are intimately coordinated, a process in which Wnt pathway plays particularly important roles. In the brain, Wnt ligands activate a cell-specific surface receptor complex to induce intracellular signaling cascades regulating neurogenesis, synaptogenesis, neuronal plasticity, synaptic plasticity, angiogenesis, vascular stabilization, and inflammation. The Wnt pathway is tightly regulated in the adult brain to maintain neurovascular functions. Historically, research in neuroscience has emphasized essentially on investigating the pathway in neurodegenerative disorders. Nonetheless, emerging findings have demonstrated that the pathway is deregulated in vascular- and traumatic-mediated brain injuries. These findings are suggesting that the pathway constitutes a promising target for the development of novel therapeutic protective and restorative interventions. Yet, targeting a complex multifunctional signal transduction pathway remains a major challenge. The review aims to summarize the current knowledge regarding the implication of Wnt pathway in the pathobiology of ischemic and hemorrhagic stroke, as well as traumatic brain injury (TBI). Furthermore, the review will present the strategies used so far to manipulate the pathway for therapeutic purposes as to highlight potential future directions. Frontiers Media S.A. 2020-09-18 /pmc/articles/PMC7530281/ /pubmed/33071819 http://dx.doi.org/10.3389/fphys.2020.565667 Text en Copyright © 2020 Menet, Lecordier and ElAli. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Physiology Menet, Romain Lecordier, Sarah ElAli, Ayman Wnt Pathway: An Emerging Player in Vascular and Traumatic Mediated Brain Injuries |
title | Wnt Pathway: An Emerging Player in Vascular and Traumatic Mediated Brain Injuries |
title_full | Wnt Pathway: An Emerging Player in Vascular and Traumatic Mediated Brain Injuries |
title_fullStr | Wnt Pathway: An Emerging Player in Vascular and Traumatic Mediated Brain Injuries |
title_full_unstemmed | Wnt Pathway: An Emerging Player in Vascular and Traumatic Mediated Brain Injuries |
title_short | Wnt Pathway: An Emerging Player in Vascular and Traumatic Mediated Brain Injuries |
title_sort | wnt pathway: an emerging player in vascular and traumatic mediated brain injuries |
topic | Physiology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7530281/ https://www.ncbi.nlm.nih.gov/pubmed/33071819 http://dx.doi.org/10.3389/fphys.2020.565667 |
work_keys_str_mv | AT menetromain wntpathwayanemergingplayerinvascularandtraumaticmediatedbraininjuries AT lecordiersarah wntpathwayanemergingplayerinvascularandtraumaticmediatedbraininjuries AT elaliayman wntpathwayanemergingplayerinvascularandtraumaticmediatedbraininjuries |