Cargando…

Hypoglycemia and Dandy-Walker variant in a Kabuki syndrome patient: a case report

BACKGROUND: Kabuki syndrome (KS) is a rare congenital condition with cardinal manifestations of typical facial features, developmental delays, skeletal anomalies, abnormal dermatoglyphic presentations, and mild to moderate intellectual disability. Pathogenic variants in two epigenetic modifier genes...

Descripción completa

Detalles Bibliográficos
Autores principales: Guo, Wei, Zhao, Yanguo, Li, Shuwei, Wang, Jingqun, Liu, Xiang
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7531129/
https://www.ncbi.nlm.nih.gov/pubmed/33008324
http://dx.doi.org/10.1186/s12881-020-01117-8
_version_ 1783589703370407936
author Guo, Wei
Zhao, Yanguo
Li, Shuwei
Wang, Jingqun
Liu, Xiang
author_facet Guo, Wei
Zhao, Yanguo
Li, Shuwei
Wang, Jingqun
Liu, Xiang
author_sort Guo, Wei
collection PubMed
description BACKGROUND: Kabuki syndrome (KS) is a rare congenital condition with cardinal manifestations of typical facial features, developmental delays, skeletal anomalies, abnormal dermatoglyphic presentations, and mild to moderate intellectual disability. Pathogenic variants in two epigenetic modifier genes, KMT2D and KDM6A, are responsible for KS1 and KS2, respectively. CASE PRESENTATION: A Chinese girl had persistent neonatal hypoglycemia and Dandy-Walker variant. Whole-exome sequencing identified a novel single nucleotide deletion in KMT2D (NM_003482.3 c.12165del p.(Glu4056Serfs*10)) that caused frameshift and premature termination. The mutation was de novo. According to the American College of Medical Genetics and Genomics (ACMG) guidelines, this variant is considered pathogenic. The patient was diagnosed with KS by molecular testing. CONCLUSION: A single novel mutation in KMT2D was identified in a KS patients with hypoglycemia and Dandy-Walker variant in the neonatal stage. A molecular test was conducted to diagnose KS at an early stage.
format Online
Article
Text
id pubmed-7531129
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-75311292020-10-05 Hypoglycemia and Dandy-Walker variant in a Kabuki syndrome patient: a case report Guo, Wei Zhao, Yanguo Li, Shuwei Wang, Jingqun Liu, Xiang BMC Med Genet Case Report BACKGROUND: Kabuki syndrome (KS) is a rare congenital condition with cardinal manifestations of typical facial features, developmental delays, skeletal anomalies, abnormal dermatoglyphic presentations, and mild to moderate intellectual disability. Pathogenic variants in two epigenetic modifier genes, KMT2D and KDM6A, are responsible for KS1 and KS2, respectively. CASE PRESENTATION: A Chinese girl had persistent neonatal hypoglycemia and Dandy-Walker variant. Whole-exome sequencing identified a novel single nucleotide deletion in KMT2D (NM_003482.3 c.12165del p.(Glu4056Serfs*10)) that caused frameshift and premature termination. The mutation was de novo. According to the American College of Medical Genetics and Genomics (ACMG) guidelines, this variant is considered pathogenic. The patient was diagnosed with KS by molecular testing. CONCLUSION: A single novel mutation in KMT2D was identified in a KS patients with hypoglycemia and Dandy-Walker variant in the neonatal stage. A molecular test was conducted to diagnose KS at an early stage. BioMed Central 2020-10-02 /pmc/articles/PMC7531129/ /pubmed/33008324 http://dx.doi.org/10.1186/s12881-020-01117-8 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Case Report
Guo, Wei
Zhao, Yanguo
Li, Shuwei
Wang, Jingqun
Liu, Xiang
Hypoglycemia and Dandy-Walker variant in a Kabuki syndrome patient: a case report
title Hypoglycemia and Dandy-Walker variant in a Kabuki syndrome patient: a case report
title_full Hypoglycemia and Dandy-Walker variant in a Kabuki syndrome patient: a case report
title_fullStr Hypoglycemia and Dandy-Walker variant in a Kabuki syndrome patient: a case report
title_full_unstemmed Hypoglycemia and Dandy-Walker variant in a Kabuki syndrome patient: a case report
title_short Hypoglycemia and Dandy-Walker variant in a Kabuki syndrome patient: a case report
title_sort hypoglycemia and dandy-walker variant in a kabuki syndrome patient: a case report
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7531129/
https://www.ncbi.nlm.nih.gov/pubmed/33008324
http://dx.doi.org/10.1186/s12881-020-01117-8
work_keys_str_mv AT guowei hypoglycemiaanddandywalkervariantinakabukisyndromepatientacasereport
AT zhaoyanguo hypoglycemiaanddandywalkervariantinakabukisyndromepatientacasereport
AT lishuwei hypoglycemiaanddandywalkervariantinakabukisyndromepatientacasereport
AT wangjingqun hypoglycemiaanddandywalkervariantinakabukisyndromepatientacasereport
AT liuxiang hypoglycemiaanddandywalkervariantinakabukisyndromepatientacasereport