Cargando…
Hypoglycemia and Dandy-Walker variant in a Kabuki syndrome patient: a case report
BACKGROUND: Kabuki syndrome (KS) is a rare congenital condition with cardinal manifestations of typical facial features, developmental delays, skeletal anomalies, abnormal dermatoglyphic presentations, and mild to moderate intellectual disability. Pathogenic variants in two epigenetic modifier genes...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7531129/ https://www.ncbi.nlm.nih.gov/pubmed/33008324 http://dx.doi.org/10.1186/s12881-020-01117-8 |
_version_ | 1783589703370407936 |
---|---|
author | Guo, Wei Zhao, Yanguo Li, Shuwei Wang, Jingqun Liu, Xiang |
author_facet | Guo, Wei Zhao, Yanguo Li, Shuwei Wang, Jingqun Liu, Xiang |
author_sort | Guo, Wei |
collection | PubMed |
description | BACKGROUND: Kabuki syndrome (KS) is a rare congenital condition with cardinal manifestations of typical facial features, developmental delays, skeletal anomalies, abnormal dermatoglyphic presentations, and mild to moderate intellectual disability. Pathogenic variants in two epigenetic modifier genes, KMT2D and KDM6A, are responsible for KS1 and KS2, respectively. CASE PRESENTATION: A Chinese girl had persistent neonatal hypoglycemia and Dandy-Walker variant. Whole-exome sequencing identified a novel single nucleotide deletion in KMT2D (NM_003482.3 c.12165del p.(Glu4056Serfs*10)) that caused frameshift and premature termination. The mutation was de novo. According to the American College of Medical Genetics and Genomics (ACMG) guidelines, this variant is considered pathogenic. The patient was diagnosed with KS by molecular testing. CONCLUSION: A single novel mutation in KMT2D was identified in a KS patients with hypoglycemia and Dandy-Walker variant in the neonatal stage. A molecular test was conducted to diagnose KS at an early stage. |
format | Online Article Text |
id | pubmed-7531129 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-75311292020-10-05 Hypoglycemia and Dandy-Walker variant in a Kabuki syndrome patient: a case report Guo, Wei Zhao, Yanguo Li, Shuwei Wang, Jingqun Liu, Xiang BMC Med Genet Case Report BACKGROUND: Kabuki syndrome (KS) is a rare congenital condition with cardinal manifestations of typical facial features, developmental delays, skeletal anomalies, abnormal dermatoglyphic presentations, and mild to moderate intellectual disability. Pathogenic variants in two epigenetic modifier genes, KMT2D and KDM6A, are responsible for KS1 and KS2, respectively. CASE PRESENTATION: A Chinese girl had persistent neonatal hypoglycemia and Dandy-Walker variant. Whole-exome sequencing identified a novel single nucleotide deletion in KMT2D (NM_003482.3 c.12165del p.(Glu4056Serfs*10)) that caused frameshift and premature termination. The mutation was de novo. According to the American College of Medical Genetics and Genomics (ACMG) guidelines, this variant is considered pathogenic. The patient was diagnosed with KS by molecular testing. CONCLUSION: A single novel mutation in KMT2D was identified in a KS patients with hypoglycemia and Dandy-Walker variant in the neonatal stage. A molecular test was conducted to diagnose KS at an early stage. BioMed Central 2020-10-02 /pmc/articles/PMC7531129/ /pubmed/33008324 http://dx.doi.org/10.1186/s12881-020-01117-8 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Case Report Guo, Wei Zhao, Yanguo Li, Shuwei Wang, Jingqun Liu, Xiang Hypoglycemia and Dandy-Walker variant in a Kabuki syndrome patient: a case report |
title | Hypoglycemia and Dandy-Walker variant in a Kabuki syndrome patient: a case report |
title_full | Hypoglycemia and Dandy-Walker variant in a Kabuki syndrome patient: a case report |
title_fullStr | Hypoglycemia and Dandy-Walker variant in a Kabuki syndrome patient: a case report |
title_full_unstemmed | Hypoglycemia and Dandy-Walker variant in a Kabuki syndrome patient: a case report |
title_short | Hypoglycemia and Dandy-Walker variant in a Kabuki syndrome patient: a case report |
title_sort | hypoglycemia and dandy-walker variant in a kabuki syndrome patient: a case report |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7531129/ https://www.ncbi.nlm.nih.gov/pubmed/33008324 http://dx.doi.org/10.1186/s12881-020-01117-8 |
work_keys_str_mv | AT guowei hypoglycemiaanddandywalkervariantinakabukisyndromepatientacasereport AT zhaoyanguo hypoglycemiaanddandywalkervariantinakabukisyndromepatientacasereport AT lishuwei hypoglycemiaanddandywalkervariantinakabukisyndromepatientacasereport AT wangjingqun hypoglycemiaanddandywalkervariantinakabukisyndromepatientacasereport AT liuxiang hypoglycemiaanddandywalkervariantinakabukisyndromepatientacasereport |