Cargando…
Epithelial-mesenchymal transition of absorptive enterocytes and depletion of Peyer's patch M cells after PEDV infection
This study focused on intestinal restitution including phenotype switching of absorptive enterocytes and the abundance of different enterocyte subtypes in weaned pigs after porcine epidemic diarrhea virus (PEDV) infection. At 10 days post-PEDV-inoculation, the ratio of villus height to crypt depth i...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Elsevier Inc.
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7548064/ https://www.ncbi.nlm.nih.gov/pubmed/33059319 http://dx.doi.org/10.1016/j.virol.2020.08.018 |
_version_ | 1783592547103277056 |
---|---|
author | Chen, Ya-Mei Helm, Emma T. Groeltz-Thrush, Jennifer M. Gabler, Nicholas K. Burrough, Eric R. |
author_facet | Chen, Ya-Mei Helm, Emma T. Groeltz-Thrush, Jennifer M. Gabler, Nicholas K. Burrough, Eric R. |
author_sort | Chen, Ya-Mei |
collection | PubMed |
description | This study focused on intestinal restitution including phenotype switching of absorptive enterocytes and the abundance of different enterocyte subtypes in weaned pigs after porcine epidemic diarrhea virus (PEDV) infection. At 10 days post-PEDV-inoculation, the ratio of villus height to crypt depth in both jejunum and ileum had restored, and the PEDV antigen was not detectable. However, enterocytes at the villus tips revealed epithelial-mesenchymal transition (EMT) in the jejunum in which E-cadherin expression decreased while expression of N-cadherin, vimentin, and Snail increased. Additionally, there was reduced expression of actin in microvilli and Zonula occludens-1 (ZO-1) in tight junctions. Moreover, the protein concentration of transforming growth factor β1 (TGFβ1), which mediates EMT and cytoskeleton alteration, was increased. We also found a decreased number of Peyer's patch M cells in the ileum. These results reveal incomplete restitution of enterocytes in the jejunum and potentially impaired immune surveillance in the ileum after PEDV infection. |
format | Online Article Text |
id | pubmed-7548064 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Elsevier Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-75480642020-10-13 Epithelial-mesenchymal transition of absorptive enterocytes and depletion of Peyer's patch M cells after PEDV infection Chen, Ya-Mei Helm, Emma T. Groeltz-Thrush, Jennifer M. Gabler, Nicholas K. Burrough, Eric R. Virology Article This study focused on intestinal restitution including phenotype switching of absorptive enterocytes and the abundance of different enterocyte subtypes in weaned pigs after porcine epidemic diarrhea virus (PEDV) infection. At 10 days post-PEDV-inoculation, the ratio of villus height to crypt depth in both jejunum and ileum had restored, and the PEDV antigen was not detectable. However, enterocytes at the villus tips revealed epithelial-mesenchymal transition (EMT) in the jejunum in which E-cadherin expression decreased while expression of N-cadherin, vimentin, and Snail increased. Additionally, there was reduced expression of actin in microvilli and Zonula occludens-1 (ZO-1) in tight junctions. Moreover, the protein concentration of transforming growth factor β1 (TGFβ1), which mediates EMT and cytoskeleton alteration, was increased. We also found a decreased number of Peyer's patch M cells in the ileum. These results reveal incomplete restitution of enterocytes in the jejunum and potentially impaired immune surveillance in the ileum after PEDV infection. Elsevier Inc. 2021-01-02 2020-10-11 /pmc/articles/PMC7548064/ /pubmed/33059319 http://dx.doi.org/10.1016/j.virol.2020.08.018 Text en © 2020 Elsevier Inc. All rights reserved. Since January 2020 Elsevier has created a COVID-19 resource centre with free information in English and Mandarin on the novel coronavirus COVID-19. The COVID-19 resource centre is hosted on Elsevier Connect, the company's public news and information website. Elsevier hereby grants permission to make all its COVID-19-related research that is available on the COVID-19 resource centre - including this research content - immediately available in PubMed Central and other publicly funded repositories, such as the WHO COVID database with rights for unrestricted research re-use and analyses in any form or by any means with acknowledgement of the original source. These permissions are granted for free by Elsevier for as long as the COVID-19 resource centre remains active. |
spellingShingle | Article Chen, Ya-Mei Helm, Emma T. Groeltz-Thrush, Jennifer M. Gabler, Nicholas K. Burrough, Eric R. Epithelial-mesenchymal transition of absorptive enterocytes and depletion of Peyer's patch M cells after PEDV infection |
title | Epithelial-mesenchymal transition of absorptive enterocytes and depletion of Peyer's patch M cells after PEDV infection |
title_full | Epithelial-mesenchymal transition of absorptive enterocytes and depletion of Peyer's patch M cells after PEDV infection |
title_fullStr | Epithelial-mesenchymal transition of absorptive enterocytes and depletion of Peyer's patch M cells after PEDV infection |
title_full_unstemmed | Epithelial-mesenchymal transition of absorptive enterocytes and depletion of Peyer's patch M cells after PEDV infection |
title_short | Epithelial-mesenchymal transition of absorptive enterocytes and depletion of Peyer's patch M cells after PEDV infection |
title_sort | epithelial-mesenchymal transition of absorptive enterocytes and depletion of peyer's patch m cells after pedv infection |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7548064/ https://www.ncbi.nlm.nih.gov/pubmed/33059319 http://dx.doi.org/10.1016/j.virol.2020.08.018 |
work_keys_str_mv | AT chenyamei epithelialmesenchymaltransitionofabsorptiveenterocytesanddepletionofpeyerspatchmcellsafterpedvinfection AT helmemmat epithelialmesenchymaltransitionofabsorptiveenterocytesanddepletionofpeyerspatchmcellsafterpedvinfection AT groeltzthrushjenniferm epithelialmesenchymaltransitionofabsorptiveenterocytesanddepletionofpeyerspatchmcellsafterpedvinfection AT gablernicholask epithelialmesenchymaltransitionofabsorptiveenterocytesanddepletionofpeyerspatchmcellsafterpedvinfection AT burroughericr epithelialmesenchymaltransitionofabsorptiveenterocytesanddepletionofpeyerspatchmcellsafterpedvinfection |