Cargando…

A pilot cluster randomised trial of the medicines and alcohol consultation (MAC): an intervention to discuss alcohol use in community pharmacy medicine review services

BACKGROUND: Alcohol interventions are important to the developing public health role of community pharmacies. The Medicines and Alcohol Consultation (MAC) is a new intervention, co-produced with community pharmacists (CPs) and patients, which involves a CP practice development programme designed to...

Descripción completa

Detalles Bibliográficos
Autores principales: Stewart, Duncan, van Dongen, Anne, Watson, Michelle, Mandefield, Laura, Atkin, Karl, Dhital, Ranjita, Foster, Brent, Gough, Brendan, Hewitt, Catherine, Madden, Mary, Morris, Stephanie, O’Carroll, Ronan, Ogden, Margaret, Parrott, Steve, Watson, Judith, White, Sue, Whittlesea, Cate, McCambridge, Jim
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7552554/
https://www.ncbi.nlm.nih.gov/pubmed/33046094
http://dx.doi.org/10.1186/s12913-020-05797-z
_version_ 1783593424408018944
author Stewart, Duncan
van Dongen, Anne
Watson, Michelle
Mandefield, Laura
Atkin, Karl
Dhital, Ranjita
Foster, Brent
Gough, Brendan
Hewitt, Catherine
Madden, Mary
Morris, Stephanie
O’Carroll, Ronan
Ogden, Margaret
Parrott, Steve
Watson, Judith
White, Sue
Whittlesea, Cate
McCambridge, Jim
author_facet Stewart, Duncan
van Dongen, Anne
Watson, Michelle
Mandefield, Laura
Atkin, Karl
Dhital, Ranjita
Foster, Brent
Gough, Brendan
Hewitt, Catherine
Madden, Mary
Morris, Stephanie
O’Carroll, Ronan
Ogden, Margaret
Parrott, Steve
Watson, Judith
White, Sue
Whittlesea, Cate
McCambridge, Jim
author_sort Stewart, Duncan
collection PubMed
description BACKGROUND: Alcohol interventions are important to the developing public health role of community pharmacies. The Medicines and Alcohol Consultation (MAC) is a new intervention, co-produced with community pharmacists (CPs) and patients, which involves a CP practice development programme designed to integrate discussion of alcohol within existing NHS medicine review services. We conducted a pilot trial of the MAC and its delivery to investigate all study procedures to inform progression to a definitive trial. METHODS: This cluster pilot RCT was conducted in 10 community pharmacies in Yorkshire, UK, with a CP from each who regularly conducted Medicine Use Review (MUR) and New Medicine Service (NMS) consultations. Randomisation was conducted using a secure remote randomisation service. Intervention CPs (n = 5) were trained to deliver the MAC in MUR/NMS consultations. Control CPs (n = 5) provided these services as usual. Consecutive MUR/NMS patients were asked by CPs to participate, screened for eligibility (consumption of alcohol at least twice per week), and baseline data collected for those eligible. A two-month follow-up telephone interview was conducted. Blinding of CPs was not possible, but patients were blinded to the alcohol focus of the trial. Primary outcomes were total weekly UK units (8 g of ethanol per unit) of alcohol consumption in the week prior to follow-up, and confidence in medications management. Trial procedures were assessed by recruitment, attrition, and follow-up rates. RESULTS: 260 patients were approached by CPs to take part in the trial, 68% (n = 178) were assessed for eligibility and 30% (n = 54) of these patients were eligible. Almost all eligible patients (n = 51; 94%) consented to participate, of whom 92% (n = 47) were followed-up at 2 months; alcohol consumption was lower in the intervention arm and confidence in medication management reduced slightly for both groups. Exploration of recall issues at follow-up showed a high level of agreement between a two-item quantity/frequency measure and 7-day guided recall of alcohol consumption. CONCLUSIONS: The pilot trial demonstrates the feasibility of implementing the MAC in community pharmacy and trial recruitment and data collection procedures. However, decommissioning of MURs means that it is not possible to conduct a definitive trial of the intervention in this service. TRIAL REGISTRATION: ISRCTN57447996
format Online
Article
Text
id pubmed-7552554
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-75525542020-10-13 A pilot cluster randomised trial of the medicines and alcohol consultation (MAC): an intervention to discuss alcohol use in community pharmacy medicine review services Stewart, Duncan van Dongen, Anne Watson, Michelle Mandefield, Laura Atkin, Karl Dhital, Ranjita Foster, Brent Gough, Brendan Hewitt, Catherine Madden, Mary Morris, Stephanie O’Carroll, Ronan Ogden, Margaret Parrott, Steve Watson, Judith White, Sue Whittlesea, Cate McCambridge, Jim BMC Health Serv Res Research Article BACKGROUND: Alcohol interventions are important to the developing public health role of community pharmacies. The Medicines and Alcohol Consultation (MAC) is a new intervention, co-produced with community pharmacists (CPs) and patients, which involves a CP practice development programme designed to integrate discussion of alcohol within existing NHS medicine review services. We conducted a pilot trial of the MAC and its delivery to investigate all study procedures to inform progression to a definitive trial. METHODS: This cluster pilot RCT was conducted in 10 community pharmacies in Yorkshire, UK, with a CP from each who regularly conducted Medicine Use Review (MUR) and New Medicine Service (NMS) consultations. Randomisation was conducted using a secure remote randomisation service. Intervention CPs (n = 5) were trained to deliver the MAC in MUR/NMS consultations. Control CPs (n = 5) provided these services as usual. Consecutive MUR/NMS patients were asked by CPs to participate, screened for eligibility (consumption of alcohol at least twice per week), and baseline data collected for those eligible. A two-month follow-up telephone interview was conducted. Blinding of CPs was not possible, but patients were blinded to the alcohol focus of the trial. Primary outcomes were total weekly UK units (8 g of ethanol per unit) of alcohol consumption in the week prior to follow-up, and confidence in medications management. Trial procedures were assessed by recruitment, attrition, and follow-up rates. RESULTS: 260 patients were approached by CPs to take part in the trial, 68% (n = 178) were assessed for eligibility and 30% (n = 54) of these patients were eligible. Almost all eligible patients (n = 51; 94%) consented to participate, of whom 92% (n = 47) were followed-up at 2 months; alcohol consumption was lower in the intervention arm and confidence in medication management reduced slightly for both groups. Exploration of recall issues at follow-up showed a high level of agreement between a two-item quantity/frequency measure and 7-day guided recall of alcohol consumption. CONCLUSIONS: The pilot trial demonstrates the feasibility of implementing the MAC in community pharmacy and trial recruitment and data collection procedures. However, decommissioning of MURs means that it is not possible to conduct a definitive trial of the intervention in this service. TRIAL REGISTRATION: ISRCTN57447996 BioMed Central 2020-10-12 /pmc/articles/PMC7552554/ /pubmed/33046094 http://dx.doi.org/10.1186/s12913-020-05797-z Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
Stewart, Duncan
van Dongen, Anne
Watson, Michelle
Mandefield, Laura
Atkin, Karl
Dhital, Ranjita
Foster, Brent
Gough, Brendan
Hewitt, Catherine
Madden, Mary
Morris, Stephanie
O’Carroll, Ronan
Ogden, Margaret
Parrott, Steve
Watson, Judith
White, Sue
Whittlesea, Cate
McCambridge, Jim
A pilot cluster randomised trial of the medicines and alcohol consultation (MAC): an intervention to discuss alcohol use in community pharmacy medicine review services
title A pilot cluster randomised trial of the medicines and alcohol consultation (MAC): an intervention to discuss alcohol use in community pharmacy medicine review services
title_full A pilot cluster randomised trial of the medicines and alcohol consultation (MAC): an intervention to discuss alcohol use in community pharmacy medicine review services
title_fullStr A pilot cluster randomised trial of the medicines and alcohol consultation (MAC): an intervention to discuss alcohol use in community pharmacy medicine review services
title_full_unstemmed A pilot cluster randomised trial of the medicines and alcohol consultation (MAC): an intervention to discuss alcohol use in community pharmacy medicine review services
title_short A pilot cluster randomised trial of the medicines and alcohol consultation (MAC): an intervention to discuss alcohol use in community pharmacy medicine review services
title_sort pilot cluster randomised trial of the medicines and alcohol consultation (mac): an intervention to discuss alcohol use in community pharmacy medicine review services
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7552554/
https://www.ncbi.nlm.nih.gov/pubmed/33046094
http://dx.doi.org/10.1186/s12913-020-05797-z
work_keys_str_mv AT stewartduncan apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT vandongenanne apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT watsonmichelle apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT mandefieldlaura apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT atkinkarl apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT dhitalranjita apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT fosterbrent apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT goughbrendan apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT hewittcatherine apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT maddenmary apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT morrisstephanie apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT ocarrollronan apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT ogdenmargaret apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT parrottsteve apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT watsonjudith apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT whitesue apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT whittleseacate apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT mccambridgejim apilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT stewartduncan pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT vandongenanne pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT watsonmichelle pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT mandefieldlaura pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT atkinkarl pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT dhitalranjita pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT fosterbrent pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT goughbrendan pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT hewittcatherine pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT maddenmary pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT morrisstephanie pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT ocarrollronan pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT ogdenmargaret pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT parrottsteve pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT watsonjudith pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT whitesue pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT whittleseacate pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices
AT mccambridgejim pilotclusterrandomisedtrialofthemedicinesandalcoholconsultationmacaninterventiontodiscussalcoholuseincommunitypharmacymedicinereviewservices