Cargando…

Anti‐LGI1, anti‐GABABR, and Anti‐CASPR2 encephalitides in Asia: A systematic review

AIM: We aim to review the literature to collate and describe features of encephalitides arising from autoantibodies against leucine‐rich glioma‐inactivated 1 (LGI1), gamma aminobutyric acid receptor (GABABR), and contactin‐associated protein‐like 2 (CASPR2) in Asian populations and compare them with...

Descripción completa

Detalles Bibliográficos
Autores principales: Ghimire, Prinska, Khanal, Ujjwal Prakash, Gajurel, Bikram Prasad, Karn, Ragesh, Rajbhandari, Reema, Paudel, Sunanda, Gautam, Niraj, Ojha, Rajeev
Formato: Online Artículo Texto
Lenguaje:English
Publicado: John Wiley and Sons Inc. 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7559615/
https://www.ncbi.nlm.nih.gov/pubmed/32783406
http://dx.doi.org/10.1002/brb3.1793
_version_ 1783594900962410496
author Ghimire, Prinska
Khanal, Ujjwal Prakash
Gajurel, Bikram Prasad
Karn, Ragesh
Rajbhandari, Reema
Paudel, Sunanda
Gautam, Niraj
Ojha, Rajeev
author_facet Ghimire, Prinska
Khanal, Ujjwal Prakash
Gajurel, Bikram Prasad
Karn, Ragesh
Rajbhandari, Reema
Paudel, Sunanda
Gautam, Niraj
Ojha, Rajeev
author_sort Ghimire, Prinska
collection PubMed
description AIM: We aim to review the literature to collate and describe features of encephalitides arising from autoantibodies against leucine‐rich glioma‐inactivated 1 (LGI1), gamma aminobutyric acid receptor (GABABR), and contactin‐associated protein‐like 2 (CASPR2) in Asian populations and compare them with findings of Western studies. METHODS: Peer‐reviewed articles published till 24 May 2020 were searched, and original, full‐text studies from Asia with serum/CSF antibody‐based diagnosis and at least 2 patients were selected. Twenty‐four studies with 263 patients (139 anti‐LGI1, 114 anti‐GAGABR, and 10 anti‐CASPR2) were included. Data were pooled to produce descriptive information on demographics, clinical characteristics, diagnostics, treatments, and outcome. RESULTS: The mean age was 54.2 (anti‐LGI1), 55.2 (anti‐GABABR), and 47.7 years (anti‐CASPR2), with an overall male predominance of 62.0%. Commonest clinical features across all types were seizures (87.5%), memory deficits (80.7%), psychiatric disturbances (75.9%), and altered consciousness (52.9%). Four anti‐LGI1, 40 anti‐GABABR, and 1 anti‐CASPR2 patients had tumors. CSF, MRI, and EEG were abnormal in 33.3%, 54.1%, and 75% patients in anti‐LGI1; 60.0%, 49.6%, and 85.7% in anti‐GABABR; and 50%, 44.4%, and 100% in anti‐CASPR2 patients, respectively. 95.6% patients received first‐line therapy alone (steroids/IVIG/Plasma therapy), and 4.4% received second‐line therapy (rituximab/cyclophosphamide). 91.7%, 63.6%, and 70% of patients had favorable outcomes (modified Rankin Score 0–2) with mortality rates at 2.5%, 23.2%, and 0% in the three types, respectively. CONCLUSION: Our findings suggest that these disorders present in Asian patients at a relatively young age often with features of seizures, memory deficits, and psychiatric disturbances and usually demonstrate a favorable clinical outcome.
format Online
Article
Text
id pubmed-7559615
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher John Wiley and Sons Inc.
record_format MEDLINE/PubMed
spelling pubmed-75596152020-10-20 Anti‐LGI1, anti‐GABABR, and Anti‐CASPR2 encephalitides in Asia: A systematic review Ghimire, Prinska Khanal, Ujjwal Prakash Gajurel, Bikram Prasad Karn, Ragesh Rajbhandari, Reema Paudel, Sunanda Gautam, Niraj Ojha, Rajeev Brain Behav Reviews AIM: We aim to review the literature to collate and describe features of encephalitides arising from autoantibodies against leucine‐rich glioma‐inactivated 1 (LGI1), gamma aminobutyric acid receptor (GABABR), and contactin‐associated protein‐like 2 (CASPR2) in Asian populations and compare them with findings of Western studies. METHODS: Peer‐reviewed articles published till 24 May 2020 were searched, and original, full‐text studies from Asia with serum/CSF antibody‐based diagnosis and at least 2 patients were selected. Twenty‐four studies with 263 patients (139 anti‐LGI1, 114 anti‐GAGABR, and 10 anti‐CASPR2) were included. Data were pooled to produce descriptive information on demographics, clinical characteristics, diagnostics, treatments, and outcome. RESULTS: The mean age was 54.2 (anti‐LGI1), 55.2 (anti‐GABABR), and 47.7 years (anti‐CASPR2), with an overall male predominance of 62.0%. Commonest clinical features across all types were seizures (87.5%), memory deficits (80.7%), psychiatric disturbances (75.9%), and altered consciousness (52.9%). Four anti‐LGI1, 40 anti‐GABABR, and 1 anti‐CASPR2 patients had tumors. CSF, MRI, and EEG were abnormal in 33.3%, 54.1%, and 75% patients in anti‐LGI1; 60.0%, 49.6%, and 85.7% in anti‐GABABR; and 50%, 44.4%, and 100% in anti‐CASPR2 patients, respectively. 95.6% patients received first‐line therapy alone (steroids/IVIG/Plasma therapy), and 4.4% received second‐line therapy (rituximab/cyclophosphamide). 91.7%, 63.6%, and 70% of patients had favorable outcomes (modified Rankin Score 0–2) with mortality rates at 2.5%, 23.2%, and 0% in the three types, respectively. CONCLUSION: Our findings suggest that these disorders present in Asian patients at a relatively young age often with features of seizures, memory deficits, and psychiatric disturbances and usually demonstrate a favorable clinical outcome. John Wiley and Sons Inc. 2020-08-12 /pmc/articles/PMC7559615/ /pubmed/32783406 http://dx.doi.org/10.1002/brb3.1793 Text en © 2020 The Authors. Brain and Behavior published by Wiley Periodicals LLC. This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited.
spellingShingle Reviews
Ghimire, Prinska
Khanal, Ujjwal Prakash
Gajurel, Bikram Prasad
Karn, Ragesh
Rajbhandari, Reema
Paudel, Sunanda
Gautam, Niraj
Ojha, Rajeev
Anti‐LGI1, anti‐GABABR, and Anti‐CASPR2 encephalitides in Asia: A systematic review
title Anti‐LGI1, anti‐GABABR, and Anti‐CASPR2 encephalitides in Asia: A systematic review
title_full Anti‐LGI1, anti‐GABABR, and Anti‐CASPR2 encephalitides in Asia: A systematic review
title_fullStr Anti‐LGI1, anti‐GABABR, and Anti‐CASPR2 encephalitides in Asia: A systematic review
title_full_unstemmed Anti‐LGI1, anti‐GABABR, and Anti‐CASPR2 encephalitides in Asia: A systematic review
title_short Anti‐LGI1, anti‐GABABR, and Anti‐CASPR2 encephalitides in Asia: A systematic review
title_sort anti‐lgi1, anti‐gababr, and anti‐caspr2 encephalitides in asia: a systematic review
topic Reviews
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7559615/
https://www.ncbi.nlm.nih.gov/pubmed/32783406
http://dx.doi.org/10.1002/brb3.1793
work_keys_str_mv AT ghimireprinska antilgi1antigababrandanticaspr2encephalitidesinasiaasystematicreview
AT khanalujjwalprakash antilgi1antigababrandanticaspr2encephalitidesinasiaasystematicreview
AT gajurelbikramprasad antilgi1antigababrandanticaspr2encephalitidesinasiaasystematicreview
AT karnragesh antilgi1antigababrandanticaspr2encephalitidesinasiaasystematicreview
AT rajbhandarireema antilgi1antigababrandanticaspr2encephalitidesinasiaasystematicreview
AT paudelsunanda antilgi1antigababrandanticaspr2encephalitidesinasiaasystematicreview
AT gautamniraj antilgi1antigababrandanticaspr2encephalitidesinasiaasystematicreview
AT ojharajeev antilgi1antigababrandanticaspr2encephalitidesinasiaasystematicreview