Cargando…

The relationship between serum 25-hydroxyvitamin D and parathyroid hormone concentration in assessing vitamin D deficiency in pet rabbits

BACKGROUND: Vitamin D deficiency and related metabolic bone diseases in pet rabbits have been intermittently debated. In human research, the parathyroid hormone concentration in relation to the 25-hydroxyvitamin D concentration is used to determine vitamin D deficiency. Thus, this study aimed to ide...

Descripción completa

Detalles Bibliográficos
Autores principales: Mäkitaipale, J., Sankari, S., Sievänen, H., Laitinen-Vapaavuori, O.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7590739/
https://www.ncbi.nlm.nih.gov/pubmed/33109180
http://dx.doi.org/10.1186/s12917-020-02599-7
_version_ 1783600864346243072
author Mäkitaipale, J.
Sankari, S.
Sievänen, H.
Laitinen-Vapaavuori, O.
author_facet Mäkitaipale, J.
Sankari, S.
Sievänen, H.
Laitinen-Vapaavuori, O.
author_sort Mäkitaipale, J.
collection PubMed
description BACKGROUND: Vitamin D deficiency and related metabolic bone diseases in pet rabbits have been intermittently debated. In human research, the parathyroid hormone concentration in relation to the 25-hydroxyvitamin D concentration is used to determine vitamin D deficiency. Thus, this study aimed to identify the breakpoint in the 25-hydroxyvitamin D concentration indicating a significant change in the parathyroid hormone concentration in 139 pet rabbits. An enzyme immunoassay kit was used for 25-hydroxyvitamin D analysis and the intact parathyroid hormone (PTH 1–84) immunoradiometric assay kit for parathyroid hormone analysis. The mid-tibial cortical bone density was measured using peripheral quantitative computed tomography. A segmented linear regression analysis was performed, with the 25-hydroxyvitamin D concentration as the independent variable, and parathyroid hormone, ionised calcium, total calcium, inorganic phosphorus concentrations and the mid-tibial cortical density as the dependent variables. RESULTS: The breakpoint for the parathyroid hormone concentration occurred at a 25(OH)D concentration of 17 ng/mL, whereas the cortical bone density breakpoint occurred at a 25-hydroxyvitamin D concentration of 19 ng/mL. No breakpoints were found for ionised calcium, total calcium or phosphorus. CONCLUSIONS: These results suggest that a serum 25-hydroxyvitamin D concentration of 17 ng/mL serves as the threshold for vitamin D deficiency in rabbits. Nearly one-third of the rabbits had a serum 25-hydroxyvitamin D concentration below this threshold. Concerns persist regarding the high prevalence of vitamin D deficiency in pet rabbits and the possible health consequences caused by a chronic vitamin D deficiency, including the risk for metabolic bone diseases.
format Online
Article
Text
id pubmed-7590739
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-75907392020-10-27 The relationship between serum 25-hydroxyvitamin D and parathyroid hormone concentration in assessing vitamin D deficiency in pet rabbits Mäkitaipale, J. Sankari, S. Sievänen, H. Laitinen-Vapaavuori, O. BMC Vet Res Research Article BACKGROUND: Vitamin D deficiency and related metabolic bone diseases in pet rabbits have been intermittently debated. In human research, the parathyroid hormone concentration in relation to the 25-hydroxyvitamin D concentration is used to determine vitamin D deficiency. Thus, this study aimed to identify the breakpoint in the 25-hydroxyvitamin D concentration indicating a significant change in the parathyroid hormone concentration in 139 pet rabbits. An enzyme immunoassay kit was used for 25-hydroxyvitamin D analysis and the intact parathyroid hormone (PTH 1–84) immunoradiometric assay kit for parathyroid hormone analysis. The mid-tibial cortical bone density was measured using peripheral quantitative computed tomography. A segmented linear regression analysis was performed, with the 25-hydroxyvitamin D concentration as the independent variable, and parathyroid hormone, ionised calcium, total calcium, inorganic phosphorus concentrations and the mid-tibial cortical density as the dependent variables. RESULTS: The breakpoint for the parathyroid hormone concentration occurred at a 25(OH)D concentration of 17 ng/mL, whereas the cortical bone density breakpoint occurred at a 25-hydroxyvitamin D concentration of 19 ng/mL. No breakpoints were found for ionised calcium, total calcium or phosphorus. CONCLUSIONS: These results suggest that a serum 25-hydroxyvitamin D concentration of 17 ng/mL serves as the threshold for vitamin D deficiency in rabbits. Nearly one-third of the rabbits had a serum 25-hydroxyvitamin D concentration below this threshold. Concerns persist regarding the high prevalence of vitamin D deficiency in pet rabbits and the possible health consequences caused by a chronic vitamin D deficiency, including the risk for metabolic bone diseases. BioMed Central 2020-10-27 /pmc/articles/PMC7590739/ /pubmed/33109180 http://dx.doi.org/10.1186/s12917-020-02599-7 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
Mäkitaipale, J.
Sankari, S.
Sievänen, H.
Laitinen-Vapaavuori, O.
The relationship between serum 25-hydroxyvitamin D and parathyroid hormone concentration in assessing vitamin D deficiency in pet rabbits
title The relationship between serum 25-hydroxyvitamin D and parathyroid hormone concentration in assessing vitamin D deficiency in pet rabbits
title_full The relationship between serum 25-hydroxyvitamin D and parathyroid hormone concentration in assessing vitamin D deficiency in pet rabbits
title_fullStr The relationship between serum 25-hydroxyvitamin D and parathyroid hormone concentration in assessing vitamin D deficiency in pet rabbits
title_full_unstemmed The relationship between serum 25-hydroxyvitamin D and parathyroid hormone concentration in assessing vitamin D deficiency in pet rabbits
title_short The relationship between serum 25-hydroxyvitamin D and parathyroid hormone concentration in assessing vitamin D deficiency in pet rabbits
title_sort relationship between serum 25-hydroxyvitamin d and parathyroid hormone concentration in assessing vitamin d deficiency in pet rabbits
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7590739/
https://www.ncbi.nlm.nih.gov/pubmed/33109180
http://dx.doi.org/10.1186/s12917-020-02599-7
work_keys_str_mv AT makitaipalej therelationshipbetweenserum25hydroxyvitamindandparathyroidhormoneconcentrationinassessingvitaminddeficiencyinpetrabbits
AT sankaris therelationshipbetweenserum25hydroxyvitamindandparathyroidhormoneconcentrationinassessingvitaminddeficiencyinpetrabbits
AT sievanenh therelationshipbetweenserum25hydroxyvitamindandparathyroidhormoneconcentrationinassessingvitaminddeficiencyinpetrabbits
AT laitinenvapaavuorio therelationshipbetweenserum25hydroxyvitamindandparathyroidhormoneconcentrationinassessingvitaminddeficiencyinpetrabbits
AT makitaipalej relationshipbetweenserum25hydroxyvitamindandparathyroidhormoneconcentrationinassessingvitaminddeficiencyinpetrabbits
AT sankaris relationshipbetweenserum25hydroxyvitamindandparathyroidhormoneconcentrationinassessingvitaminddeficiencyinpetrabbits
AT sievanenh relationshipbetweenserum25hydroxyvitamindandparathyroidhormoneconcentrationinassessingvitaminddeficiencyinpetrabbits
AT laitinenvapaavuorio relationshipbetweenserum25hydroxyvitamindandparathyroidhormoneconcentrationinassessingvitaminddeficiencyinpetrabbits