Cargando…
Chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line
Defensins are antimicrobial peptides composed of 3 conserved disulfide bridges, a β-sheet, and both hydrophobic and cationic amino acids. In this study, we aimed to demonstrate the immunomodulation role of avian β-defensin 8 (AvBD8) in a chicken macrophage cell line. Chicken AvBD8 stimulated the exp...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Elsevier
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7598012/ https://www.ncbi.nlm.nih.gov/pubmed/32867961 http://dx.doi.org/10.1016/j.psj.2020.05.027 |
_version_ | 1783602498298183680 |
---|---|
author | Hong, Yeojin Lee, Jiae Vu, Thi Hao Lee, Sooyeon Lillehoj, Hyun S. Hong, Yeong Ho |
author_facet | Hong, Yeojin Lee, Jiae Vu, Thi Hao Lee, Sooyeon Lillehoj, Hyun S. Hong, Yeong Ho |
author_sort | Hong, Yeojin |
collection | PubMed |
description | Defensins are antimicrobial peptides composed of 3 conserved disulfide bridges, a β-sheet, and both hydrophobic and cationic amino acids. In this study, we aimed to demonstrate the immunomodulation role of avian β-defensin 8 (AvBD8) in a chicken macrophage cell line. Chicken AvBD8 stimulated the expression of proinflammatory cytokines (IL-1β, interferon gamma, and IL-12p40) and chemokines (CCL4, CXCL13, and CCL20) in macrophages. Furthermore, by Western blotting and immunocytochemistry, we confirmed that AvBD8 activated the mitogen-activated protein kinase signaling pathway via extracellular regulated kinases 1/2 and p38 signaling molecules. Overall, AvBD8 plays a crucial role in host defense as not only an antimicrobial peptide but also an immunomodulator by activating the mitogen-activated protein kinase signaling pathway and inducing the expression of proinflammatory cytokines and chemokines. |
format | Online Article Text |
id | pubmed-7598012 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Elsevier |
record_format | MEDLINE/PubMed |
spelling | pubmed-75980122020-11-03 Chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line Hong, Yeojin Lee, Jiae Vu, Thi Hao Lee, Sooyeon Lillehoj, Hyun S. Hong, Yeong Ho Poult Sci Genetics and Molecular Biology Defensins are antimicrobial peptides composed of 3 conserved disulfide bridges, a β-sheet, and both hydrophobic and cationic amino acids. In this study, we aimed to demonstrate the immunomodulation role of avian β-defensin 8 (AvBD8) in a chicken macrophage cell line. Chicken AvBD8 stimulated the expression of proinflammatory cytokines (IL-1β, interferon gamma, and IL-12p40) and chemokines (CCL4, CXCL13, and CCL20) in macrophages. Furthermore, by Western blotting and immunocytochemistry, we confirmed that AvBD8 activated the mitogen-activated protein kinase signaling pathway via extracellular regulated kinases 1/2 and p38 signaling molecules. Overall, AvBD8 plays a crucial role in host defense as not only an antimicrobial peptide but also an immunomodulator by activating the mitogen-activated protein kinase signaling pathway and inducing the expression of proinflammatory cytokines and chemokines. Elsevier 2020-06-24 /pmc/articles/PMC7598012/ /pubmed/32867961 http://dx.doi.org/10.1016/j.psj.2020.05.027 Text en © 2020 Published by Elsevier Inc. on behalf of Poultry Science Association Inc. http://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/). |
spellingShingle | Genetics and Molecular Biology Hong, Yeojin Lee, Jiae Vu, Thi Hao Lee, Sooyeon Lillehoj, Hyun S. Hong, Yeong Ho Chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line |
title | Chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line |
title_full | Chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line |
title_fullStr | Chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line |
title_full_unstemmed | Chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line |
title_short | Chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line |
title_sort | chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line |
topic | Genetics and Molecular Biology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7598012/ https://www.ncbi.nlm.nih.gov/pubmed/32867961 http://dx.doi.org/10.1016/j.psj.2020.05.027 |
work_keys_str_mv | AT hongyeojin chickenavianbdefensin8modulatesimmuneresponseviathemitogenactivatedproteinkinasesignalingpathwaysinachickenmacrophagecellline AT leejiae chickenavianbdefensin8modulatesimmuneresponseviathemitogenactivatedproteinkinasesignalingpathwaysinachickenmacrophagecellline AT vuthihao chickenavianbdefensin8modulatesimmuneresponseviathemitogenactivatedproteinkinasesignalingpathwaysinachickenmacrophagecellline AT leesooyeon chickenavianbdefensin8modulatesimmuneresponseviathemitogenactivatedproteinkinasesignalingpathwaysinachickenmacrophagecellline AT lillehojhyuns chickenavianbdefensin8modulatesimmuneresponseviathemitogenactivatedproteinkinasesignalingpathwaysinachickenmacrophagecellline AT hongyeongho chickenavianbdefensin8modulatesimmuneresponseviathemitogenactivatedproteinkinasesignalingpathwaysinachickenmacrophagecellline |