Cargando…

Chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line

Defensins are antimicrobial peptides composed of 3 conserved disulfide bridges, a β-sheet, and both hydrophobic and cationic amino acids. In this study, we aimed to demonstrate the immunomodulation role of avian β-defensin 8 (AvBD8) in a chicken macrophage cell line. Chicken AvBD8 stimulated the exp...

Descripción completa

Detalles Bibliográficos
Autores principales: Hong, Yeojin, Lee, Jiae, Vu, Thi Hao, Lee, Sooyeon, Lillehoj, Hyun S., Hong, Yeong Ho
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Elsevier 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7598012/
https://www.ncbi.nlm.nih.gov/pubmed/32867961
http://dx.doi.org/10.1016/j.psj.2020.05.027
_version_ 1783602498298183680
author Hong, Yeojin
Lee, Jiae
Vu, Thi Hao
Lee, Sooyeon
Lillehoj, Hyun S.
Hong, Yeong Ho
author_facet Hong, Yeojin
Lee, Jiae
Vu, Thi Hao
Lee, Sooyeon
Lillehoj, Hyun S.
Hong, Yeong Ho
author_sort Hong, Yeojin
collection PubMed
description Defensins are antimicrobial peptides composed of 3 conserved disulfide bridges, a β-sheet, and both hydrophobic and cationic amino acids. In this study, we aimed to demonstrate the immunomodulation role of avian β-defensin 8 (AvBD8) in a chicken macrophage cell line. Chicken AvBD8 stimulated the expression of proinflammatory cytokines (IL-1β, interferon gamma, and IL-12p40) and chemokines (CCL4, CXCL13, and CCL20) in macrophages. Furthermore, by Western blotting and immunocytochemistry, we confirmed that AvBD8 activated the mitogen-activated protein kinase signaling pathway via extracellular regulated kinases 1/2 and p38 signaling molecules. Overall, AvBD8 plays a crucial role in host defense as not only an antimicrobial peptide but also an immunomodulator by activating the mitogen-activated protein kinase signaling pathway and inducing the expression of proinflammatory cytokines and chemokines.
format Online
Article
Text
id pubmed-7598012
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Elsevier
record_format MEDLINE/PubMed
spelling pubmed-75980122020-11-03 Chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line Hong, Yeojin Lee, Jiae Vu, Thi Hao Lee, Sooyeon Lillehoj, Hyun S. Hong, Yeong Ho Poult Sci Genetics and Molecular Biology Defensins are antimicrobial peptides composed of 3 conserved disulfide bridges, a β-sheet, and both hydrophobic and cationic amino acids. In this study, we aimed to demonstrate the immunomodulation role of avian β-defensin 8 (AvBD8) in a chicken macrophage cell line. Chicken AvBD8 stimulated the expression of proinflammatory cytokines (IL-1β, interferon gamma, and IL-12p40) and chemokines (CCL4, CXCL13, and CCL20) in macrophages. Furthermore, by Western blotting and immunocytochemistry, we confirmed that AvBD8 activated the mitogen-activated protein kinase signaling pathway via extracellular regulated kinases 1/2 and p38 signaling molecules. Overall, AvBD8 plays a crucial role in host defense as not only an antimicrobial peptide but also an immunomodulator by activating the mitogen-activated protein kinase signaling pathway and inducing the expression of proinflammatory cytokines and chemokines. Elsevier 2020-06-24 /pmc/articles/PMC7598012/ /pubmed/32867961 http://dx.doi.org/10.1016/j.psj.2020.05.027 Text en © 2020 Published by Elsevier Inc. on behalf of Poultry Science Association Inc. http://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/).
spellingShingle Genetics and Molecular Biology
Hong, Yeojin
Lee, Jiae
Vu, Thi Hao
Lee, Sooyeon
Lillehoj, Hyun S.
Hong, Yeong Ho
Chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line
title Chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line
title_full Chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line
title_fullStr Chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line
title_full_unstemmed Chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line
title_short Chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line
title_sort chicken avian β-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line
topic Genetics and Molecular Biology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7598012/
https://www.ncbi.nlm.nih.gov/pubmed/32867961
http://dx.doi.org/10.1016/j.psj.2020.05.027
work_keys_str_mv AT hongyeojin chickenavianbdefensin8modulatesimmuneresponseviathemitogenactivatedproteinkinasesignalingpathwaysinachickenmacrophagecellline
AT leejiae chickenavianbdefensin8modulatesimmuneresponseviathemitogenactivatedproteinkinasesignalingpathwaysinachickenmacrophagecellline
AT vuthihao chickenavianbdefensin8modulatesimmuneresponseviathemitogenactivatedproteinkinasesignalingpathwaysinachickenmacrophagecellline
AT leesooyeon chickenavianbdefensin8modulatesimmuneresponseviathemitogenactivatedproteinkinasesignalingpathwaysinachickenmacrophagecellline
AT lillehojhyuns chickenavianbdefensin8modulatesimmuneresponseviathemitogenactivatedproteinkinasesignalingpathwaysinachickenmacrophagecellline
AT hongyeongho chickenavianbdefensin8modulatesimmuneresponseviathemitogenactivatedproteinkinasesignalingpathwaysinachickenmacrophagecellline