Cargando…

Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)

Chemosensory proteins (CSP) are a class of acidic soluble proteins which have various functions in chemoreception, resistance and immunity, but we still have very little knowledge on this gene family in fig wasps, a peculiar insects group (Hymenoptera, Chalcidoidea) that shelter in the fig syconia o...

Descripción completa

Detalles Bibliográficos
Autores principales: Xin, Zhaozhe, Huang, Dawei, Zhao, Dan, Li, Jiaxing, Wei, Xianqin, Xiao, Jinhua
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7599541/
https://www.ncbi.nlm.nih.gov/pubmed/33003564
http://dx.doi.org/10.3390/genes11101149
_version_ 1783602900332707840
author Xin, Zhaozhe
Huang, Dawei
Zhao, Dan
Li, Jiaxing
Wei, Xianqin
Xiao, Jinhua
author_facet Xin, Zhaozhe
Huang, Dawei
Zhao, Dan
Li, Jiaxing
Wei, Xianqin
Xiao, Jinhua
author_sort Xin, Zhaozhe
collection PubMed
description Chemosensory proteins (CSP) are a class of acidic soluble proteins which have various functions in chemoreception, resistance and immunity, but we still have very little knowledge on this gene family in fig wasps, a peculiar insects group (Hymenoptera, Chalcidoidea) that shelter in the fig syconia of Ficus trees. Here, we made the first comprehensive analysis of CSP gene family in the 11 fig wasps at whole-genome level. We manually annotated 104 CSP genes in the genomes of the 11 fig wasps, comprehensively analyzed them in gene characteristics, conserved cysteine patterns, motif orders, phylogeny, genome distribution, gene tandem duplication, and expansion and contraction patterns of the gene family. We also approximately predicted the gene expression by codon adaptation index analysis. Our study shows that the CSP gene family is conserved in the 11 fig wasps; the CSP gene numbers in pollinating fig wasps are less than in non-pollinating fig wasps, which may be due to their longer history of adaptation to fig syconia; the expansion of CSP gene in two non-pollinating fig wasps, Philotrypesis tridentata and Sycophaga agraensis, may be a species-specific phenomenon. These results provide us with useful information for understanding the evolution of the CSP gene family of insects in diverse living environments.
format Online
Article
Text
id pubmed-7599541
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-75995412020-11-01 Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea) Xin, Zhaozhe Huang, Dawei Zhao, Dan Li, Jiaxing Wei, Xianqin Xiao, Jinhua Genes (Basel) Article Chemosensory proteins (CSP) are a class of acidic soluble proteins which have various functions in chemoreception, resistance and immunity, but we still have very little knowledge on this gene family in fig wasps, a peculiar insects group (Hymenoptera, Chalcidoidea) that shelter in the fig syconia of Ficus trees. Here, we made the first comprehensive analysis of CSP gene family in the 11 fig wasps at whole-genome level. We manually annotated 104 CSP genes in the genomes of the 11 fig wasps, comprehensively analyzed them in gene characteristics, conserved cysteine patterns, motif orders, phylogeny, genome distribution, gene tandem duplication, and expansion and contraction patterns of the gene family. We also approximately predicted the gene expression by codon adaptation index analysis. Our study shows that the CSP gene family is conserved in the 11 fig wasps; the CSP gene numbers in pollinating fig wasps are less than in non-pollinating fig wasps, which may be due to their longer history of adaptation to fig syconia; the expansion of CSP gene in two non-pollinating fig wasps, Philotrypesis tridentata and Sycophaga agraensis, may be a species-specific phenomenon. These results provide us with useful information for understanding the evolution of the CSP gene family of insects in diverse living environments. MDPI 2020-09-29 /pmc/articles/PMC7599541/ /pubmed/33003564 http://dx.doi.org/10.3390/genes11101149 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Xin, Zhaozhe
Huang, Dawei
Zhao, Dan
Li, Jiaxing
Wei, Xianqin
Xiao, Jinhua
Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)
title Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)
title_full Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)
title_fullStr Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)
title_full_unstemmed Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)
title_short Genome-Wide Analysis of Chemosensory Protein Genes (CSPs) Family in Fig Wasps (Hymenoptera, Chalcidoidea)
title_sort genome-wide analysis of chemosensory protein genes (csps) family in fig wasps (hymenoptera, chalcidoidea)
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7599541/
https://www.ncbi.nlm.nih.gov/pubmed/33003564
http://dx.doi.org/10.3390/genes11101149
work_keys_str_mv AT xinzhaozhe genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea
AT huangdawei genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea
AT zhaodan genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea
AT lijiaxing genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea
AT weixianqin genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea
AT xiaojinhua genomewideanalysisofchemosensoryproteingenescspsfamilyinfigwaspshymenopterachalcidoidea