Cargando…

Why does uptake of family planning services remain sub-optimal among Nigerian women? A systematic review of challenges and implications for policy

BACKGROUND: Over the years, family planning uptake in Nigeria has remained low and this is as a result of the various challenges and barriers faced by women. The aim of this study was to systematically review studies on family planning services undertaken in Nigeria in order to understand the challe...

Descripción completa

Detalles Bibliográficos
Autores principales: Akamike, Ifeyinwa Chizoba, Okedo-Alex, Ijeoma Nkem, Eze, Irene Ifeyinwa, Ezeanosike, Obumneme Benaiah, Uneke, Chigozie Jesse
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7603738/
https://www.ncbi.nlm.nih.gov/pubmed/33292842
http://dx.doi.org/10.1186/s40834-020-00133-6
_version_ 1783603990572826624
author Akamike, Ifeyinwa Chizoba
Okedo-Alex, Ijeoma Nkem
Eze, Irene Ifeyinwa
Ezeanosike, Obumneme Benaiah
Uneke, Chigozie Jesse
author_facet Akamike, Ifeyinwa Chizoba
Okedo-Alex, Ijeoma Nkem
Eze, Irene Ifeyinwa
Ezeanosike, Obumneme Benaiah
Uneke, Chigozie Jesse
author_sort Akamike, Ifeyinwa Chizoba
collection PubMed
description BACKGROUND: Over the years, family planning uptake in Nigeria has remained low and this is as a result of the various challenges and barriers faced by women. The aim of this study was to systematically review studies on family planning services undertaken in Nigeria in order to understand the challenges to uptake of the services and the policy implications. METHODS: A PubMed search was performed in June 2020 and studies that investigated challenges of family planning uptake in Nigeria published in English between 2006 and 2020 were sought. A combination of the search terms family planning, contraceptives, challenges, barriers, Nigeria was used. Review articles, case reports, and case studies were excluded. Studies that did not report barriers or challenges to family planning or contraceptives were excluded. RESULT: Twenty seven studies carried out in Nigeria which provided sufficient information were identified and used for this review. The Uptake of family planning recorded in the reviewed studies ranges from 10.3 to 66.8%. Challenges that are client related include education, desire for more children, uncertainty about its need, partner disapproval, previous side effects, religious beliefs, culture disapproval, age, marital status, and wealth index, residence, ignorance, embarrassment, domestic violence and sexual factor. Health service related factors identified include cost, difficulty accessing services, and procurement difficulties. Recommendations for family planning propram and policy include targeting of health service delivery for improvement, focus on gender issues and male involvement, involvement of religious leaders, targeting of younger women for better education and counseling, and continuous awareness creation and counseling among others. CONCLUSION: The review has shown that uptake of family planning remains low in Nigeria and challenges abound. We recommend that strategies that are multi-sectoral should be applied to address the multi-pronged challenges facing uptake of family planning services. SUPPLEMENTARY INFORMATION: Supplementary information accompanies this paper at 10.1186/s40834-020-00133-6.
format Online
Article
Text
id pubmed-7603738
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-76037382020-11-02 Why does uptake of family planning services remain sub-optimal among Nigerian women? A systematic review of challenges and implications for policy Akamike, Ifeyinwa Chizoba Okedo-Alex, Ijeoma Nkem Eze, Irene Ifeyinwa Ezeanosike, Obumneme Benaiah Uneke, Chigozie Jesse Contracept Reprod Med Research BACKGROUND: Over the years, family planning uptake in Nigeria has remained low and this is as a result of the various challenges and barriers faced by women. The aim of this study was to systematically review studies on family planning services undertaken in Nigeria in order to understand the challenges to uptake of the services and the policy implications. METHODS: A PubMed search was performed in June 2020 and studies that investigated challenges of family planning uptake in Nigeria published in English between 2006 and 2020 were sought. A combination of the search terms family planning, contraceptives, challenges, barriers, Nigeria was used. Review articles, case reports, and case studies were excluded. Studies that did not report barriers or challenges to family planning or contraceptives were excluded. RESULT: Twenty seven studies carried out in Nigeria which provided sufficient information were identified and used for this review. The Uptake of family planning recorded in the reviewed studies ranges from 10.3 to 66.8%. Challenges that are client related include education, desire for more children, uncertainty about its need, partner disapproval, previous side effects, religious beliefs, culture disapproval, age, marital status, and wealth index, residence, ignorance, embarrassment, domestic violence and sexual factor. Health service related factors identified include cost, difficulty accessing services, and procurement difficulties. Recommendations for family planning propram and policy include targeting of health service delivery for improvement, focus on gender issues and male involvement, involvement of religious leaders, targeting of younger women for better education and counseling, and continuous awareness creation and counseling among others. CONCLUSION: The review has shown that uptake of family planning remains low in Nigeria and challenges abound. We recommend that strategies that are multi-sectoral should be applied to address the multi-pronged challenges facing uptake of family planning services. SUPPLEMENTARY INFORMATION: Supplementary information accompanies this paper at 10.1186/s40834-020-00133-6. BioMed Central 2020-10-31 /pmc/articles/PMC7603738/ /pubmed/33292842 http://dx.doi.org/10.1186/s40834-020-00133-6 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Akamike, Ifeyinwa Chizoba
Okedo-Alex, Ijeoma Nkem
Eze, Irene Ifeyinwa
Ezeanosike, Obumneme Benaiah
Uneke, Chigozie Jesse
Why does uptake of family planning services remain sub-optimal among Nigerian women? A systematic review of challenges and implications for policy
title Why does uptake of family planning services remain sub-optimal among Nigerian women? A systematic review of challenges and implications for policy
title_full Why does uptake of family planning services remain sub-optimal among Nigerian women? A systematic review of challenges and implications for policy
title_fullStr Why does uptake of family planning services remain sub-optimal among Nigerian women? A systematic review of challenges and implications for policy
title_full_unstemmed Why does uptake of family planning services remain sub-optimal among Nigerian women? A systematic review of challenges and implications for policy
title_short Why does uptake of family planning services remain sub-optimal among Nigerian women? A systematic review of challenges and implications for policy
title_sort why does uptake of family planning services remain sub-optimal among nigerian women? a systematic review of challenges and implications for policy
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7603738/
https://www.ncbi.nlm.nih.gov/pubmed/33292842
http://dx.doi.org/10.1186/s40834-020-00133-6
work_keys_str_mv AT akamikeifeyinwachizoba whydoesuptakeoffamilyplanningservicesremainsuboptimalamongnigerianwomenasystematicreviewofchallengesandimplicationsforpolicy
AT okedoalexijeomankem whydoesuptakeoffamilyplanningservicesremainsuboptimalamongnigerianwomenasystematicreviewofchallengesandimplicationsforpolicy
AT ezeireneifeyinwa whydoesuptakeoffamilyplanningservicesremainsuboptimalamongnigerianwomenasystematicreviewofchallengesandimplicationsforpolicy
AT ezeanosikeobumnemebenaiah whydoesuptakeoffamilyplanningservicesremainsuboptimalamongnigerianwomenasystematicreviewofchallengesandimplicationsforpolicy
AT unekechigoziejesse whydoesuptakeoffamilyplanningservicesremainsuboptimalamongnigerianwomenasystematicreviewofchallengesandimplicationsforpolicy