Cargando…
Biomolecular endotype factors involved in COVID-19 airway infectivity: A systematic review
OBJECTIVES: To review the current knowledge of biomolecular factors surrounding otorhinolaryngeal illnesses and analyze their presence in COVID-19 virulence. Emphasis was placed on cytokines and vitamin D for determining susceptibility of illness. METHODS: A primary literature search of PubMed and G...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Oto-Rhino-Laryngological Society of Japan Inc. Published by Elsevier B.V.
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7685037/ https://www.ncbi.nlm.nih.gov/pubmed/33257107 http://dx.doi.org/10.1016/j.anl.2020.11.006 |
_version_ | 1783613117904715776 |
---|---|
author | Jain, Neil Varman, Rahul Tarbox, James A. Nguyen, Tam |
author_facet | Jain, Neil Varman, Rahul Tarbox, James A. Nguyen, Tam |
author_sort | Jain, Neil |
collection | PubMed |
description | OBJECTIVES: To review the current knowledge of biomolecular factors surrounding otorhinolaryngeal illnesses and analyze their presence in COVID-19 virulence. Emphasis was placed on cytokines and vitamin D for determining susceptibility of illness. METHODS: A primary literature search of PubMed and Google Scholar for articles published between January 1, 2002 to May 31, 2020, was performed without language restrictions from May 8, 2020 to May 31, 2020. A focused second search was conducted from October 31, 2020 to November 2, 2020 for articles published between January 1, 2002 to October 31, 2020. Eligible articles were selected after evaluation of titles, abstracts, and references. A total of 45 were included in this review. RESULTS: Differing endotype classification schemes are used to determine cytokines present in chronic rhinosinusitis, asthma, and allergies. While immunologic responses and biomarkers are primary methods of differentiation, recent literature has also implicated geographic distribution of chronic rhinosinusitis patients in accounting for cytokine variations. The cytokines of interest (IL-4, IL-13, and INF-γ) present in the endotypes of these conditions may point towards protective mechanisms against COVID-19 through downregulation of the ACE2 receptor. These cytokines and Vitamin D highlight new areas of study for factors affecting SARS-CoV-2 virulence. CONCLUSIONS: Further research is needed to understand the effects of Vitamin D and the various cytokines prevalent among endotypes of nasal/pharyngeal illnesses on COVID-19 pathogenesis. Findings may point towards epidemiologic trends of SARS-CoV-2 transmission and have future therapeutic indications. |
format | Online Article Text |
id | pubmed-7685037 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Oto-Rhino-Laryngological Society of Japan Inc. Published by Elsevier B.V. |
record_format | MEDLINE/PubMed |
spelling | pubmed-76850372020-11-25 Biomolecular endotype factors involved in COVID-19 airway infectivity: A systematic review Jain, Neil Varman, Rahul Tarbox, James A. Nguyen, Tam Auris Nasus Larynx Article OBJECTIVES: To review the current knowledge of biomolecular factors surrounding otorhinolaryngeal illnesses and analyze their presence in COVID-19 virulence. Emphasis was placed on cytokines and vitamin D for determining susceptibility of illness. METHODS: A primary literature search of PubMed and Google Scholar for articles published between January 1, 2002 to May 31, 2020, was performed without language restrictions from May 8, 2020 to May 31, 2020. A focused second search was conducted from October 31, 2020 to November 2, 2020 for articles published between January 1, 2002 to October 31, 2020. Eligible articles were selected after evaluation of titles, abstracts, and references. A total of 45 were included in this review. RESULTS: Differing endotype classification schemes are used to determine cytokines present in chronic rhinosinusitis, asthma, and allergies. While immunologic responses and biomarkers are primary methods of differentiation, recent literature has also implicated geographic distribution of chronic rhinosinusitis patients in accounting for cytokine variations. The cytokines of interest (IL-4, IL-13, and INF-γ) present in the endotypes of these conditions may point towards protective mechanisms against COVID-19 through downregulation of the ACE2 receptor. These cytokines and Vitamin D highlight new areas of study for factors affecting SARS-CoV-2 virulence. CONCLUSIONS: Further research is needed to understand the effects of Vitamin D and the various cytokines prevalent among endotypes of nasal/pharyngeal illnesses on COVID-19 pathogenesis. Findings may point towards epidemiologic trends of SARS-CoV-2 transmission and have future therapeutic indications. Oto-Rhino-Laryngological Society of Japan Inc. Published by Elsevier B.V. 2021-02 2020-11-24 /pmc/articles/PMC7685037/ /pubmed/33257107 http://dx.doi.org/10.1016/j.anl.2020.11.006 Text en © 2020 Oto-Rhino-Laryngological Society of Japan Inc. Published by Elsevier B.V. All rights reserved. Since January 2020 Elsevier has created a COVID-19 resource centre with free information in English and Mandarin on the novel coronavirus COVID-19. The COVID-19 resource centre is hosted on Elsevier Connect, the company's public news and information website. Elsevier hereby grants permission to make all its COVID-19-related research that is available on the COVID-19 resource centre - including this research content - immediately available in PubMed Central and other publicly funded repositories, such as the WHO COVID database with rights for unrestricted research re-use and analyses in any form or by any means with acknowledgement of the original source. These permissions are granted for free by Elsevier for as long as the COVID-19 resource centre remains active. |
spellingShingle | Article Jain, Neil Varman, Rahul Tarbox, James A. Nguyen, Tam Biomolecular endotype factors involved in COVID-19 airway infectivity: A systematic review |
title | Biomolecular endotype factors involved in COVID-19 airway infectivity: A systematic review |
title_full | Biomolecular endotype factors involved in COVID-19 airway infectivity: A systematic review |
title_fullStr | Biomolecular endotype factors involved in COVID-19 airway infectivity: A systematic review |
title_full_unstemmed | Biomolecular endotype factors involved in COVID-19 airway infectivity: A systematic review |
title_short | Biomolecular endotype factors involved in COVID-19 airway infectivity: A systematic review |
title_sort | biomolecular endotype factors involved in covid-19 airway infectivity: a systematic review |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7685037/ https://www.ncbi.nlm.nih.gov/pubmed/33257107 http://dx.doi.org/10.1016/j.anl.2020.11.006 |
work_keys_str_mv | AT jainneil biomolecularendotypefactorsinvolvedincovid19airwayinfectivityasystematicreview AT varmanrahul biomolecularendotypefactorsinvolvedincovid19airwayinfectivityasystematicreview AT tarboxjamesa biomolecularendotypefactorsinvolvedincovid19airwayinfectivityasystematicreview AT nguyentam biomolecularendotypefactorsinvolvedincovid19airwayinfectivityasystematicreview |