Cargando…

Immune Checkpoint Inhibitor-Associated Scleroderma-Like Syndrome: A Report of a Pembrolizumab-Induced “Eosinophilic Fasciitis-Like” Case and a Review of the Literature

Immune checkpoint inhibitors are a promising new therapeutic strategy in oncology that aims to eliminate cancer cells by enhancing patients' immune response against tumor antigens. Despite their beneficial effects, immune checkpoint inhibitors are also responsible for a plethora of autoimmune m...

Descripción completa

Detalles Bibliográficos
Autores principales: Salamaliki, Christina, Solomou, Elena E., Liossis, Stamatis-Nick C.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Springer Healthcare 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7695772/
https://www.ncbi.nlm.nih.gov/pubmed/33067734
http://dx.doi.org/10.1007/s40744-020-00246-z
_version_ 1783615262467031040
author Salamaliki, Christina
Solomou, Elena E.
Liossis, Stamatis-Nick C.
author_facet Salamaliki, Christina
Solomou, Elena E.
Liossis, Stamatis-Nick C.
author_sort Salamaliki, Christina
collection PubMed
description Immune checkpoint inhibitors are a promising new therapeutic strategy in oncology that aims to eliminate cancer cells by enhancing patients' immune response against tumor antigens. Despite their beneficial effects, immune checkpoint inhibitors are also responsible for a plethora of autoimmune manifestations, known as immune-related adverse events. We present a case of eosinophilic fasciitis-like disorder in an 81-year-old patient treated with the programmed death cell protein 1 inhibitor pembrolizumab for non-small-cell lung cancer. The patient developed characteristic indurated skin lesions in his limbs after 1½ years of treatment with pembrolizumab and a typical “groove sign.” Raynaud’s syndrome was absent. A full-thickness biopsy confirmed the clinical diagnosis of an “EF-like” condition. Neither peripheral eosinophilia nor eosinophilic infiltrates in the skin biopsy were found. His symptoms improved after a 2.5-month CPI discontinuation and treatment with 16 mg of methylprednisolone slowly tapered to a dose of 4 mg. Eosinophilic fasciitis is a rare immune-related adverse event of CPI treatment; our literature search identified only 12 cases that fulfill the criteria of EF in patients receiving CPIs.
format Online
Article
Text
id pubmed-7695772
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Springer Healthcare
record_format MEDLINE/PubMed
spelling pubmed-76957722020-11-30 Immune Checkpoint Inhibitor-Associated Scleroderma-Like Syndrome: A Report of a Pembrolizumab-Induced “Eosinophilic Fasciitis-Like” Case and a Review of the Literature Salamaliki, Christina Solomou, Elena E. Liossis, Stamatis-Nick C. Rheumatol Ther Case Report Immune checkpoint inhibitors are a promising new therapeutic strategy in oncology that aims to eliminate cancer cells by enhancing patients' immune response against tumor antigens. Despite their beneficial effects, immune checkpoint inhibitors are also responsible for a plethora of autoimmune manifestations, known as immune-related adverse events. We present a case of eosinophilic fasciitis-like disorder in an 81-year-old patient treated with the programmed death cell protein 1 inhibitor pembrolizumab for non-small-cell lung cancer. The patient developed characteristic indurated skin lesions in his limbs after 1½ years of treatment with pembrolizumab and a typical “groove sign.” Raynaud’s syndrome was absent. A full-thickness biopsy confirmed the clinical diagnosis of an “EF-like” condition. Neither peripheral eosinophilia nor eosinophilic infiltrates in the skin biopsy were found. His symptoms improved after a 2.5-month CPI discontinuation and treatment with 16 mg of methylprednisolone slowly tapered to a dose of 4 mg. Eosinophilic fasciitis is a rare immune-related adverse event of CPI treatment; our literature search identified only 12 cases that fulfill the criteria of EF in patients receiving CPIs. Springer Healthcare 2020-10-16 /pmc/articles/PMC7695772/ /pubmed/33067734 http://dx.doi.org/10.1007/s40744-020-00246-z Text en © The Author(s) 2020 Open Access This article is licensed under a Creative Commons Attribution-NonCommercial 4.0 International License, which permits any non-commercial use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by-nc/4.0/.
spellingShingle Case Report
Salamaliki, Christina
Solomou, Elena E.
Liossis, Stamatis-Nick C.
Immune Checkpoint Inhibitor-Associated Scleroderma-Like Syndrome: A Report of a Pembrolizumab-Induced “Eosinophilic Fasciitis-Like” Case and a Review of the Literature
title Immune Checkpoint Inhibitor-Associated Scleroderma-Like Syndrome: A Report of a Pembrolizumab-Induced “Eosinophilic Fasciitis-Like” Case and a Review of the Literature
title_full Immune Checkpoint Inhibitor-Associated Scleroderma-Like Syndrome: A Report of a Pembrolizumab-Induced “Eosinophilic Fasciitis-Like” Case and a Review of the Literature
title_fullStr Immune Checkpoint Inhibitor-Associated Scleroderma-Like Syndrome: A Report of a Pembrolizumab-Induced “Eosinophilic Fasciitis-Like” Case and a Review of the Literature
title_full_unstemmed Immune Checkpoint Inhibitor-Associated Scleroderma-Like Syndrome: A Report of a Pembrolizumab-Induced “Eosinophilic Fasciitis-Like” Case and a Review of the Literature
title_short Immune Checkpoint Inhibitor-Associated Scleroderma-Like Syndrome: A Report of a Pembrolizumab-Induced “Eosinophilic Fasciitis-Like” Case and a Review of the Literature
title_sort immune checkpoint inhibitor-associated scleroderma-like syndrome: a report of a pembrolizumab-induced “eosinophilic fasciitis-like” case and a review of the literature
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7695772/
https://www.ncbi.nlm.nih.gov/pubmed/33067734
http://dx.doi.org/10.1007/s40744-020-00246-z
work_keys_str_mv AT salamalikichristina immunecheckpointinhibitorassociatedsclerodermalikesyndromeareportofapembrolizumabinducedeosinophilicfasciitislikecaseandareviewoftheliterature
AT solomouelenae immunecheckpointinhibitorassociatedsclerodermalikesyndromeareportofapembrolizumabinducedeosinophilicfasciitislikecaseandareviewoftheliterature
AT liossisstamatisnickc immunecheckpointinhibitorassociatedsclerodermalikesyndromeareportofapembrolizumabinducedeosinophilicfasciitislikecaseandareviewoftheliterature