Cargando…
Typology of psychiatric emergency services in the United Kingdom: a narrative literature review
BACKGROUND: Mental health crisis requiring emergency access to psychiatric service can occur at any time. Psychiatric Emergency Service (PES) is described as one that provides an immediate response to an individual in crisis within the first 24 h. Presently, several types of PESs are available in th...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7727184/ https://www.ncbi.nlm.nih.gov/pubmed/33302905 http://dx.doi.org/10.1186/s12888-020-02983-5 |
_version_ | 1783621049643958272 |
---|---|
author | Odejimi, Opeyemi Bagchi, Dhruba Tadros, George |
author_facet | Odejimi, Opeyemi Bagchi, Dhruba Tadros, George |
author_sort | Odejimi, Opeyemi |
collection | PubMed |
description | BACKGROUND: Mental health crisis requiring emergency access to psychiatric service can occur at any time. Psychiatric Emergency Service (PES) is described as one that provides an immediate response to an individual in crisis within the first 24 h. Presently, several types of PESs are available in the United Kingdom (UK) with the aim of providing prompt and effective assessment and management of patients. Therefore, this study aims to provide a detailed narrative literature review of the various types of Psychiatric Emergency Service (PES) currently available in the UK. METHOD: Electronic search of five key databases (MEDLINE, PsychINFO, EMBASE, AMED and PUBMED) was conducted. Studies were included if it described a mental health service in the UK that provides immediate response in mental health crisis within the first 24 h. Excluded studies did not describe a PES, non-English, and were not conducted in UK. RESULTS: Nine types of PESs were found. Amongst the 9 services, more papers described crisis resolution home treatment. Majority of the papers reported services within England than other countries within the UK. CONCLUSION: All types of PESs were described as beneficial, particularly to mental health service users, but not without some shortcomings. There is a need to continue carrying out methodological research that evaluate impact, cost-effectiveness as well as identify methods of optimising the beneficial outcomes of the various types of PESs. This may help inform researchers, policy makers and commissioners, service users and carers, service providers and many more on how to ensure current and future PESs meet the needs as well as aid recovery during crisis. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12888-020-02983-5. |
format | Online Article Text |
id | pubmed-7727184 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-77271842020-12-11 Typology of psychiatric emergency services in the United Kingdom: a narrative literature review Odejimi, Opeyemi Bagchi, Dhruba Tadros, George BMC Psychiatry Research Article BACKGROUND: Mental health crisis requiring emergency access to psychiatric service can occur at any time. Psychiatric Emergency Service (PES) is described as one that provides an immediate response to an individual in crisis within the first 24 h. Presently, several types of PESs are available in the United Kingdom (UK) with the aim of providing prompt and effective assessment and management of patients. Therefore, this study aims to provide a detailed narrative literature review of the various types of Psychiatric Emergency Service (PES) currently available in the UK. METHOD: Electronic search of five key databases (MEDLINE, PsychINFO, EMBASE, AMED and PUBMED) was conducted. Studies were included if it described a mental health service in the UK that provides immediate response in mental health crisis within the first 24 h. Excluded studies did not describe a PES, non-English, and were not conducted in UK. RESULTS: Nine types of PESs were found. Amongst the 9 services, more papers described crisis resolution home treatment. Majority of the papers reported services within England than other countries within the UK. CONCLUSION: All types of PESs were described as beneficial, particularly to mental health service users, but not without some shortcomings. There is a need to continue carrying out methodological research that evaluate impact, cost-effectiveness as well as identify methods of optimising the beneficial outcomes of the various types of PESs. This may help inform researchers, policy makers and commissioners, service users and carers, service providers and many more on how to ensure current and future PESs meet the needs as well as aid recovery during crisis. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12888-020-02983-5. BioMed Central 2020-12-10 /pmc/articles/PMC7727184/ /pubmed/33302905 http://dx.doi.org/10.1186/s12888-020-02983-5 Text en © The Author(s) 2020 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Article Odejimi, Opeyemi Bagchi, Dhruba Tadros, George Typology of psychiatric emergency services in the United Kingdom: a narrative literature review |
title | Typology of psychiatric emergency services in the United Kingdom: a narrative literature review |
title_full | Typology of psychiatric emergency services in the United Kingdom: a narrative literature review |
title_fullStr | Typology of psychiatric emergency services in the United Kingdom: a narrative literature review |
title_full_unstemmed | Typology of psychiatric emergency services in the United Kingdom: a narrative literature review |
title_short | Typology of psychiatric emergency services in the United Kingdom: a narrative literature review |
title_sort | typology of psychiatric emergency services in the united kingdom: a narrative literature review |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7727184/ https://www.ncbi.nlm.nih.gov/pubmed/33302905 http://dx.doi.org/10.1186/s12888-020-02983-5 |
work_keys_str_mv | AT odejimiopeyemi typologyofpsychiatricemergencyservicesintheunitedkingdomanarrativeliteraturereview AT bagchidhruba typologyofpsychiatricemergencyservicesintheunitedkingdomanarrativeliteraturereview AT tadrosgeorge typologyofpsychiatricemergencyservicesintheunitedkingdomanarrativeliteraturereview |