The mitochondrial genome of a social wasp, Vespa simillima simillima (Hymenoptera: Vespidae)

We analyzed the complete mitochondrial genome of a social wasp, Vespa simillima simillima from South Korea prior to a systematic study on Korean Vespidae. The mitogenome is 16,740 bp in length, includes 13 protein-coding genes (PCGs), 22 tRNAs, 2 rRNAs, and a 228 bp short A + T-rich region. The over...

Descripción completa

Detalles Bibliográficos
Autores principales: Choi, Moon-Bo, Ha, Young-Ho, Kim, Il-Kown, Oh, Seung Hwan, Kim, Chang-Jun
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2019
Materias:
Mitogenome Announcement
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7748423/
https://www.ncbi.nlm.nih.gov/pubmed/33366515
http://dx.doi.org/10.1080/23802359.2019.1699458
_version_ 1783625108174143488
author Choi, Moon-Bo
Ha, Young-Ho
Kim, Il-Kown
Oh, Seung Hwan
Kim, Chang-Jun
author_facet Choi, Moon-Bo
Ha, Young-Ho
Kim, Il-Kown
Oh, Seung Hwan
Kim, Chang-Jun
author_sort Choi, Moon-Bo
collection PubMed
description We analyzed the complete mitochondrial genome of a social wasp, Vespa simillima simillima from South Korea prior to a systematic study on Korean Vespidae. The mitogenome is 16,740 bp in length, includes 13 protein-coding genes (PCGs), 22 tRNAs, 2 rRNAs, and a 228 bp short A + T-rich region. The overall base composition is 82.0% AT and 18.0% GC. The maximum-likelihood analysis suggested that V. s. simillima is closely related to V. bicolor, another species of Vespidae.
format Online
Article
Text
id pubmed-7748423
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-77484232020-12-22 The mitochondrial genome of a social wasp, Vespa simillima simillima (Hymenoptera: Vespidae) Choi, Moon-Bo Ha, Young-Ho Kim, Il-Kown Oh, Seung Hwan Kim, Chang-Jun Mitochondrial DNA B Resour Mitogenome Announcement We analyzed the complete mitochondrial genome of a social wasp, Vespa simillima simillima from South Korea prior to a systematic study on Korean Vespidae. The mitogenome is 16,740 bp in length, includes 13 protein-coding genes (PCGs), 22 tRNAs, 2 rRNAs, and a 228 bp short A + T-rich region. The overall base composition is 82.0% AT and 18.0% GC. The maximum-likelihood analysis suggested that V. s. simillima is closely related to V. bicolor, another species of Vespidae. Taylor & Francis 2019-12-13 /pmc/articles/PMC7748423/ /pubmed/33366515 http://dx.doi.org/10.1080/23802359.2019.1699458 Text en © 2019 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Mitogenome Announcement
Choi, Moon-Bo
Ha, Young-Ho
Kim, Il-Kown
Oh, Seung Hwan
Kim, Chang-Jun
The mitochondrial genome of a social wasp, Vespa simillima simillima (Hymenoptera: Vespidae)
title The mitochondrial genome of a social wasp, Vespa simillima simillima (Hymenoptera: Vespidae)
title_full The mitochondrial genome of a social wasp, Vespa simillima simillima (Hymenoptera: Vespidae)
title_fullStr The mitochondrial genome of a social wasp, Vespa simillima simillima (Hymenoptera: Vespidae)
title_full_unstemmed The mitochondrial genome of a social wasp, Vespa simillima simillima (Hymenoptera: Vespidae)
title_short The mitochondrial genome of a social wasp, Vespa simillima simillima (Hymenoptera: Vespidae)
title_sort mitochondrial genome of a social wasp, vespa simillima simillima (hymenoptera: vespidae)
topic Mitogenome Announcement
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7748423/
https://www.ncbi.nlm.nih.gov/pubmed/33366515
http://dx.doi.org/10.1080/23802359.2019.1699458
work_keys_str_mv AT choimoonbo themitochondrialgenomeofasocialwaspvespasimillimasimillimahymenopteravespidae
AT hayoungho themitochondrialgenomeofasocialwaspvespasimillimasimillimahymenopteravespidae
AT kimilkown themitochondrialgenomeofasocialwaspvespasimillimasimillimahymenopteravespidae
AT ohseunghwan themitochondrialgenomeofasocialwaspvespasimillimasimillimahymenopteravespidae
AT kimchangjun themitochondrialgenomeofasocialwaspvespasimillimasimillimahymenopteravespidae
AT choimoonbo mitochondrialgenomeofasocialwaspvespasimillimasimillimahymenopteravespidae
AT hayoungho mitochondrialgenomeofasocialwaspvespasimillimasimillimahymenopteravespidae
AT kimilkown mitochondrialgenomeofasocialwaspvespasimillimasimillimahymenopteravespidae
AT ohseunghwan mitochondrialgenomeofasocialwaspvespasimillimasimillimahymenopteravespidae
AT kimchangjun mitochondrialgenomeofasocialwaspvespasimillimasimillimahymenopteravespidae

Ejemplares similares