Cargando…

Elaphuri Davidiani Cornu Improves Depressive-Like Behavior in Mice and Increases Neurotrophic Factor Expression in Mouse Primary Astrocytes via cAMP and ERK-Dependent Pathways

Elaphuri Davidiani Cornu (EDC) is the natural shedding horn of Elaphurus davidiauus Millne-Edwards that was used by people in ancient China for maintaining physical and mental health. We evaluated the antidepressant effect of EDC using depression-like animal models and explored possible mechanisms i...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhu, Yue, Liu, Mengqiu, Qu, Suchen, Cao, Cheng, Wei, Chongqi, Meng, Xue-er, Lou, Qianyin, Qian, Dawei, Duan, Jin-ao, Ding, Yuhua, Han, Zhengxiang, Zhao, Ming
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7751692/
https://www.ncbi.nlm.nih.gov/pubmed/33364963
http://dx.doi.org/10.3389/fphar.2020.593993
_version_ 1783625707339907072
author Zhu, Yue
Liu, Mengqiu
Qu, Suchen
Cao, Cheng
Wei, Chongqi
Meng, Xue-er
Lou, Qianyin
Qian, Dawei
Duan, Jin-ao
Ding, Yuhua
Han, Zhengxiang
Zhao, Ming
author_facet Zhu, Yue
Liu, Mengqiu
Qu, Suchen
Cao, Cheng
Wei, Chongqi
Meng, Xue-er
Lou, Qianyin
Qian, Dawei
Duan, Jin-ao
Ding, Yuhua
Han, Zhengxiang
Zhao, Ming
author_sort Zhu, Yue
collection PubMed
description Elaphuri Davidiani Cornu (EDC) is the natural shedding horn of Elaphurus davidiauus Millne-Edwards that was used by people in ancient China for maintaining physical and mental health. We evaluated the antidepressant effect of EDC using depression-like animal models and explored possible mechanisms in mouse primary astrocyte cultures. We found that aqueous extracts of EDC significantly improved depression-like behavior in a mouse model of depression. The extracts enhanced expression of nerve growth factor and brain-derived neurotrophic factor neurotrophic factors in mouse prefrontal cortex and hippocampus tissues. In the mouse primary astrocyte cultures, the EDC aqueous extracts significantly increased the neurotrophic factor expression both at the transcriptional and protein levels. EDC extracts might exhibit these functions by regulating matrix metalloprotein-9 of the nerve growth factor and brain-derived neurotrophic factor metabolic pathways and might enhance expression of neurotrophic factors via the cAMP- and ERK-dependent pathways. We confirmed this possibility by showing the effects of related inhibitors, providing scientific evidence that supports the utility of EDC in the development of drugs to treat major depressive disorders.
format Online
Article
Text
id pubmed-7751692
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-77516922020-12-22 Elaphuri Davidiani Cornu Improves Depressive-Like Behavior in Mice and Increases Neurotrophic Factor Expression in Mouse Primary Astrocytes via cAMP and ERK-Dependent Pathways Zhu, Yue Liu, Mengqiu Qu, Suchen Cao, Cheng Wei, Chongqi Meng, Xue-er Lou, Qianyin Qian, Dawei Duan, Jin-ao Ding, Yuhua Han, Zhengxiang Zhao, Ming Front Pharmacol Pharmacology Elaphuri Davidiani Cornu (EDC) is the natural shedding horn of Elaphurus davidiauus Millne-Edwards that was used by people in ancient China for maintaining physical and mental health. We evaluated the antidepressant effect of EDC using depression-like animal models and explored possible mechanisms in mouse primary astrocyte cultures. We found that aqueous extracts of EDC significantly improved depression-like behavior in a mouse model of depression. The extracts enhanced expression of nerve growth factor and brain-derived neurotrophic factor neurotrophic factors in mouse prefrontal cortex and hippocampus tissues. In the mouse primary astrocyte cultures, the EDC aqueous extracts significantly increased the neurotrophic factor expression both at the transcriptional and protein levels. EDC extracts might exhibit these functions by regulating matrix metalloprotein-9 of the nerve growth factor and brain-derived neurotrophic factor metabolic pathways and might enhance expression of neurotrophic factors via the cAMP- and ERK-dependent pathways. We confirmed this possibility by showing the effects of related inhibitors, providing scientific evidence that supports the utility of EDC in the development of drugs to treat major depressive disorders. Frontiers Media S.A. 2020-11-16 /pmc/articles/PMC7751692/ /pubmed/33364963 http://dx.doi.org/10.3389/fphar.2020.593993 Text en Copyright © 2020 Zhu, Liu, Cao, Qu, Wei, Meng, Lou, Qian, Duan, Ding, Han and Zhao http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Pharmacology
Zhu, Yue
Liu, Mengqiu
Qu, Suchen
Cao, Cheng
Wei, Chongqi
Meng, Xue-er
Lou, Qianyin
Qian, Dawei
Duan, Jin-ao
Ding, Yuhua
Han, Zhengxiang
Zhao, Ming
Elaphuri Davidiani Cornu Improves Depressive-Like Behavior in Mice and Increases Neurotrophic Factor Expression in Mouse Primary Astrocytes via cAMP and ERK-Dependent Pathways
title Elaphuri Davidiani Cornu Improves Depressive-Like Behavior in Mice and Increases Neurotrophic Factor Expression in Mouse Primary Astrocytes via cAMP and ERK-Dependent Pathways
title_full Elaphuri Davidiani Cornu Improves Depressive-Like Behavior in Mice and Increases Neurotrophic Factor Expression in Mouse Primary Astrocytes via cAMP and ERK-Dependent Pathways
title_fullStr Elaphuri Davidiani Cornu Improves Depressive-Like Behavior in Mice and Increases Neurotrophic Factor Expression in Mouse Primary Astrocytes via cAMP and ERK-Dependent Pathways
title_full_unstemmed Elaphuri Davidiani Cornu Improves Depressive-Like Behavior in Mice and Increases Neurotrophic Factor Expression in Mouse Primary Astrocytes via cAMP and ERK-Dependent Pathways
title_short Elaphuri Davidiani Cornu Improves Depressive-Like Behavior in Mice and Increases Neurotrophic Factor Expression in Mouse Primary Astrocytes via cAMP and ERK-Dependent Pathways
title_sort elaphuri davidiani cornu improves depressive-like behavior in mice and increases neurotrophic factor expression in mouse primary astrocytes via camp and erk-dependent pathways
topic Pharmacology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7751692/
https://www.ncbi.nlm.nih.gov/pubmed/33364963
http://dx.doi.org/10.3389/fphar.2020.593993
work_keys_str_mv AT zhuyue elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways
AT liumengqiu elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways
AT qusuchen elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways
AT caocheng elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways
AT weichongqi elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways
AT mengxueer elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways
AT louqianyin elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways
AT qiandawei elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways
AT duanjinao elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways
AT dingyuhua elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways
AT hanzhengxiang elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways
AT zhaoming elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways