Cargando…
Elaphuri Davidiani Cornu Improves Depressive-Like Behavior in Mice and Increases Neurotrophic Factor Expression in Mouse Primary Astrocytes via cAMP and ERK-Dependent Pathways
Elaphuri Davidiani Cornu (EDC) is the natural shedding horn of Elaphurus davidiauus Millne-Edwards that was used by people in ancient China for maintaining physical and mental health. We evaluated the antidepressant effect of EDC using depression-like animal models and explored possible mechanisms i...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7751692/ https://www.ncbi.nlm.nih.gov/pubmed/33364963 http://dx.doi.org/10.3389/fphar.2020.593993 |
_version_ | 1783625707339907072 |
---|---|
author | Zhu, Yue Liu, Mengqiu Qu, Suchen Cao, Cheng Wei, Chongqi Meng, Xue-er Lou, Qianyin Qian, Dawei Duan, Jin-ao Ding, Yuhua Han, Zhengxiang Zhao, Ming |
author_facet | Zhu, Yue Liu, Mengqiu Qu, Suchen Cao, Cheng Wei, Chongqi Meng, Xue-er Lou, Qianyin Qian, Dawei Duan, Jin-ao Ding, Yuhua Han, Zhengxiang Zhao, Ming |
author_sort | Zhu, Yue |
collection | PubMed |
description | Elaphuri Davidiani Cornu (EDC) is the natural shedding horn of Elaphurus davidiauus Millne-Edwards that was used by people in ancient China for maintaining physical and mental health. We evaluated the antidepressant effect of EDC using depression-like animal models and explored possible mechanisms in mouse primary astrocyte cultures. We found that aqueous extracts of EDC significantly improved depression-like behavior in a mouse model of depression. The extracts enhanced expression of nerve growth factor and brain-derived neurotrophic factor neurotrophic factors in mouse prefrontal cortex and hippocampus tissues. In the mouse primary astrocyte cultures, the EDC aqueous extracts significantly increased the neurotrophic factor expression both at the transcriptional and protein levels. EDC extracts might exhibit these functions by regulating matrix metalloprotein-9 of the nerve growth factor and brain-derived neurotrophic factor metabolic pathways and might enhance expression of neurotrophic factors via the cAMP- and ERK-dependent pathways. We confirmed this possibility by showing the effects of related inhibitors, providing scientific evidence that supports the utility of EDC in the development of drugs to treat major depressive disorders. |
format | Online Article Text |
id | pubmed-7751692 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-77516922020-12-22 Elaphuri Davidiani Cornu Improves Depressive-Like Behavior in Mice and Increases Neurotrophic Factor Expression in Mouse Primary Astrocytes via cAMP and ERK-Dependent Pathways Zhu, Yue Liu, Mengqiu Qu, Suchen Cao, Cheng Wei, Chongqi Meng, Xue-er Lou, Qianyin Qian, Dawei Duan, Jin-ao Ding, Yuhua Han, Zhengxiang Zhao, Ming Front Pharmacol Pharmacology Elaphuri Davidiani Cornu (EDC) is the natural shedding horn of Elaphurus davidiauus Millne-Edwards that was used by people in ancient China for maintaining physical and mental health. We evaluated the antidepressant effect of EDC using depression-like animal models and explored possible mechanisms in mouse primary astrocyte cultures. We found that aqueous extracts of EDC significantly improved depression-like behavior in a mouse model of depression. The extracts enhanced expression of nerve growth factor and brain-derived neurotrophic factor neurotrophic factors in mouse prefrontal cortex and hippocampus tissues. In the mouse primary astrocyte cultures, the EDC aqueous extracts significantly increased the neurotrophic factor expression both at the transcriptional and protein levels. EDC extracts might exhibit these functions by regulating matrix metalloprotein-9 of the nerve growth factor and brain-derived neurotrophic factor metabolic pathways and might enhance expression of neurotrophic factors via the cAMP- and ERK-dependent pathways. We confirmed this possibility by showing the effects of related inhibitors, providing scientific evidence that supports the utility of EDC in the development of drugs to treat major depressive disorders. Frontiers Media S.A. 2020-11-16 /pmc/articles/PMC7751692/ /pubmed/33364963 http://dx.doi.org/10.3389/fphar.2020.593993 Text en Copyright © 2020 Zhu, Liu, Cao, Qu, Wei, Meng, Lou, Qian, Duan, Ding, Han and Zhao http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Pharmacology Zhu, Yue Liu, Mengqiu Qu, Suchen Cao, Cheng Wei, Chongqi Meng, Xue-er Lou, Qianyin Qian, Dawei Duan, Jin-ao Ding, Yuhua Han, Zhengxiang Zhao, Ming Elaphuri Davidiani Cornu Improves Depressive-Like Behavior in Mice and Increases Neurotrophic Factor Expression in Mouse Primary Astrocytes via cAMP and ERK-Dependent Pathways |
title | Elaphuri Davidiani Cornu Improves Depressive-Like Behavior in Mice and Increases Neurotrophic Factor Expression in Mouse Primary Astrocytes via cAMP and ERK-Dependent Pathways |
title_full | Elaphuri Davidiani Cornu Improves Depressive-Like Behavior in Mice and Increases Neurotrophic Factor Expression in Mouse Primary Astrocytes via cAMP and ERK-Dependent Pathways |
title_fullStr | Elaphuri Davidiani Cornu Improves Depressive-Like Behavior in Mice and Increases Neurotrophic Factor Expression in Mouse Primary Astrocytes via cAMP and ERK-Dependent Pathways |
title_full_unstemmed | Elaphuri Davidiani Cornu Improves Depressive-Like Behavior in Mice and Increases Neurotrophic Factor Expression in Mouse Primary Astrocytes via cAMP and ERK-Dependent Pathways |
title_short | Elaphuri Davidiani Cornu Improves Depressive-Like Behavior in Mice and Increases Neurotrophic Factor Expression in Mouse Primary Astrocytes via cAMP and ERK-Dependent Pathways |
title_sort | elaphuri davidiani cornu improves depressive-like behavior in mice and increases neurotrophic factor expression in mouse primary astrocytes via camp and erk-dependent pathways |
topic | Pharmacology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7751692/ https://www.ncbi.nlm.nih.gov/pubmed/33364963 http://dx.doi.org/10.3389/fphar.2020.593993 |
work_keys_str_mv | AT zhuyue elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways AT liumengqiu elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways AT qusuchen elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways AT caocheng elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways AT weichongqi elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways AT mengxueer elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways AT louqianyin elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways AT qiandawei elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways AT duanjinao elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways AT dingyuhua elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways AT hanzhengxiang elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways AT zhaoming elaphuridavidianicornuimprovesdepressivelikebehaviorinmiceandincreasesneurotrophicfactorexpressioninmouseprimaryastrocytesviacampanderkdependentpathways |