Cargando…

Replacing Forage by Crude Olive Cake in a Dairy Sheep Diet: Effects on Ruminal Fermentation and Microbial Populations in Rusitec Fermenters

SIMPLE SUMMARY: Large amounts of olive cake are generated after olive oil extraction, representing an environmental pollutant whose disposal is highly expensive for olive-processing companies. Using olive cake in ruminant feeding is a possible alternative, as it is a good source of fiber and contain...

Descripción completa

Detalles Bibliográficos
Autores principales: García-Rodríguez, Jairo, Mateos, Iván, Saro, Cristina, González, Jesús S., Carro, María Dolores, Ranilla, María José
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7759795/
https://www.ncbi.nlm.nih.gov/pubmed/33260716
http://dx.doi.org/10.3390/ani10122235
_version_ 1783627181025394688
author García-Rodríguez, Jairo
Mateos, Iván
Saro, Cristina
González, Jesús S.
Carro, María Dolores
Ranilla, María José
author_facet García-Rodríguez, Jairo
Mateos, Iván
Saro, Cristina
González, Jesús S.
Carro, María Dolores
Ranilla, María José
author_sort García-Rodríguez, Jairo
collection PubMed
description SIMPLE SUMMARY: Large amounts of olive cake are generated after olive oil extraction, representing an environmental pollutant whose disposal is highly expensive for olive-processing companies. Using olive cake in ruminant feeding is a possible alternative, as it is a good source of fiber and contains polyphenols, although its nutritive value needs to be properly assessed. In this study, we evaluated the effects of replacing 33% of the forage (maize silage and barley straw) by olive cake (16.6% of total diet) in a mixed diet for dairy ruminants on in vitro ruminal fermentation using Rusitec fermenters. Olive cake inclusion increased diet degradability, whereas rumen fermentation, microbial growth, and microbial populations were not modified. Results indicate that maize silage and barley straw could be partially replaced by olive cake in a diet for dairy sheep without compromising rumen fermentation. The use of olive cake in ruminant diets could be especially indicated in periods of forage scarcity. ABSTRACT: Olive oil extraction generates large amounts of a highly pollutant by-product called olive cake (OC), and its use in ruminant feeding could be an alternative. This study was designed to evaluate the effects of partially replacing forage by crude OC (COC) in a mixed dairy diet on rumen fermentation and microbial populations in Rusitec fermenters. The COC replaced 33% of the forage (66% maize silage and 33% barley straw) and was included at 16.6% of the total diet. Four fermenters were used in a cross-over design with two 13-day incubation periods. Experimental diets had a 50:50 forage-to-concentrate ratio and were formulated to contain the same protein (16.0%) and neutral detergent fiber (32.5%) levels. Compared with control fermenters, those fed the COC diet showed greater (p ≤ 0.02) pH (6.07 vs. 6.22), diet disappearance (0.709 vs. 0.748), and butyrate proportions (18.0 vs. 19.4), but there were no differences in volatile fatty acids and ammonia production. Microbial growth, bacterial diversity, protozoal abundance, and relative abundance of fungi and archaea were unaffected by diet, although the solid phase of COC-fed fermenters showed greater (p = 0.01) bacterial abundance than control ones. Results indicate that COC could replace 33% of the forage in a mixed dairy diet.
format Online
Article
Text
id pubmed-7759795
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-77597952020-12-26 Replacing Forage by Crude Olive Cake in a Dairy Sheep Diet: Effects on Ruminal Fermentation and Microbial Populations in Rusitec Fermenters García-Rodríguez, Jairo Mateos, Iván Saro, Cristina González, Jesús S. Carro, María Dolores Ranilla, María José Animals (Basel) Article SIMPLE SUMMARY: Large amounts of olive cake are generated after olive oil extraction, representing an environmental pollutant whose disposal is highly expensive for olive-processing companies. Using olive cake in ruminant feeding is a possible alternative, as it is a good source of fiber and contains polyphenols, although its nutritive value needs to be properly assessed. In this study, we evaluated the effects of replacing 33% of the forage (maize silage and barley straw) by olive cake (16.6% of total diet) in a mixed diet for dairy ruminants on in vitro ruminal fermentation using Rusitec fermenters. Olive cake inclusion increased diet degradability, whereas rumen fermentation, microbial growth, and microbial populations were not modified. Results indicate that maize silage and barley straw could be partially replaced by olive cake in a diet for dairy sheep without compromising rumen fermentation. The use of olive cake in ruminant diets could be especially indicated in periods of forage scarcity. ABSTRACT: Olive oil extraction generates large amounts of a highly pollutant by-product called olive cake (OC), and its use in ruminant feeding could be an alternative. This study was designed to evaluate the effects of partially replacing forage by crude OC (COC) in a mixed dairy diet on rumen fermentation and microbial populations in Rusitec fermenters. The COC replaced 33% of the forage (66% maize silage and 33% barley straw) and was included at 16.6% of the total diet. Four fermenters were used in a cross-over design with two 13-day incubation periods. Experimental diets had a 50:50 forage-to-concentrate ratio and were formulated to contain the same protein (16.0%) and neutral detergent fiber (32.5%) levels. Compared with control fermenters, those fed the COC diet showed greater (p ≤ 0.02) pH (6.07 vs. 6.22), diet disappearance (0.709 vs. 0.748), and butyrate proportions (18.0 vs. 19.4), but there were no differences in volatile fatty acids and ammonia production. Microbial growth, bacterial diversity, protozoal abundance, and relative abundance of fungi and archaea were unaffected by diet, although the solid phase of COC-fed fermenters showed greater (p = 0.01) bacterial abundance than control ones. Results indicate that COC could replace 33% of the forage in a mixed dairy diet. MDPI 2020-11-28 /pmc/articles/PMC7759795/ /pubmed/33260716 http://dx.doi.org/10.3390/ani10122235 Text en © 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
García-Rodríguez, Jairo
Mateos, Iván
Saro, Cristina
González, Jesús S.
Carro, María Dolores
Ranilla, María José
Replacing Forage by Crude Olive Cake in a Dairy Sheep Diet: Effects on Ruminal Fermentation and Microbial Populations in Rusitec Fermenters
title Replacing Forage by Crude Olive Cake in a Dairy Sheep Diet: Effects on Ruminal Fermentation and Microbial Populations in Rusitec Fermenters
title_full Replacing Forage by Crude Olive Cake in a Dairy Sheep Diet: Effects on Ruminal Fermentation and Microbial Populations in Rusitec Fermenters
title_fullStr Replacing Forage by Crude Olive Cake in a Dairy Sheep Diet: Effects on Ruminal Fermentation and Microbial Populations in Rusitec Fermenters
title_full_unstemmed Replacing Forage by Crude Olive Cake in a Dairy Sheep Diet: Effects on Ruminal Fermentation and Microbial Populations in Rusitec Fermenters
title_short Replacing Forage by Crude Olive Cake in a Dairy Sheep Diet: Effects on Ruminal Fermentation and Microbial Populations in Rusitec Fermenters
title_sort replacing forage by crude olive cake in a dairy sheep diet: effects on ruminal fermentation and microbial populations in rusitec fermenters
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7759795/
https://www.ncbi.nlm.nih.gov/pubmed/33260716
http://dx.doi.org/10.3390/ani10122235
work_keys_str_mv AT garciarodriguezjairo replacingforagebycrudeolivecakeinadairysheepdieteffectsonruminalfermentationandmicrobialpopulationsinrusitecfermenters
AT mateosivan replacingforagebycrudeolivecakeinadairysheepdieteffectsonruminalfermentationandmicrobialpopulationsinrusitecfermenters
AT sarocristina replacingforagebycrudeolivecakeinadairysheepdieteffectsonruminalfermentationandmicrobialpopulationsinrusitecfermenters
AT gonzalezjesuss replacingforagebycrudeolivecakeinadairysheepdieteffectsonruminalfermentationandmicrobialpopulationsinrusitecfermenters
AT carromariadolores replacingforagebycrudeolivecakeinadairysheepdieteffectsonruminalfermentationandmicrobialpopulationsinrusitecfermenters
AT ranillamariajose replacingforagebycrudeolivecakeinadairysheepdieteffectsonruminalfermentationandmicrobialpopulationsinrusitecfermenters