Cargando…

943. Older Gay Black Men Living with HIV Report Higher Quality of Life than Older Gay White Men, Despite Facing Additional Burdens

BACKGROUND: Improving quality of life (QoL) is an important goal of care for people living with HIV (PLWH). This analysis uses data from the Aging with Dignity, Health, Optimism and Community (ADHOC) online registry to identify the different challenges faced by older white/Caucasian (“white”) and bl...

Descripción completa

Detalles Bibliográficos
Autores principales: Mazonson, Peter, Loo, Theoren, Berko, Jeff, Adeyemi, Oluwatoyin, Oglesby, Alan, Spinelli, Frank, Zolopa, Andrew
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Oxford University Press 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7777159/
http://dx.doi.org/10.1093/ofid/ofaa439.1129
_version_ 1783630838522445824
author Mazonson, Peter
Loo, Theoren
Berko, Jeff
Adeyemi, Oluwatoyin
Oglesby, Alan
Spinelli, Frank
Zolopa, Andrew
author_facet Mazonson, Peter
Loo, Theoren
Berko, Jeff
Adeyemi, Oluwatoyin
Oglesby, Alan
Spinelli, Frank
Zolopa, Andrew
author_sort Mazonson, Peter
collection PubMed
description BACKGROUND: Improving quality of life (QoL) is an important goal of care for people living with HIV (PLWH). This analysis uses data from the Aging with Dignity, Health, Optimism and Community (ADHOC) online registry to identify the different challenges faced by older white/Caucasian (“white”) and black/African American (“black”) gay or bisexual men living with HIV, and to assess differences in total QoL between the two groups. METHODS: QoL was measured using the PozQoL, a validated instrument for PLWH. The PozQoL assesses QoL across four domains: health concerns, psychological, social, and functional wellbeing. Total QoL was determined by combining domain scores for a total score. Student’s t-tests and chi-squared tests were used to identify disparities between black and white men. Factors with p< 0.05 were used as control variables in a multivariable linear regression model where PozQoL total score was the dependent variable. RESULTS: In the ADHOC database, 91% (n=612) of respondents were white men (WM) and 9% (n=59) were black men (BM). Both BM and WM had a median age of 59 years, and had a similar number of comorbidities (7.9 vs 9.2 respectively, p=0.12). Compared to WM, BM were more likely to be single (74% vs 51%, p< 0.001), less likely to have an income greater than $50,000 (25% vs 56%, p< 0.001), less likely to have a college degree or more (42% vs 69%, p=0.034), and less likely to be virally suppressed (87% vs 96%, p=0.001). Even after controlling for these differences in the multivariable model, BM had significantly higher total QoL than WM (Table 1). CONCLUSION: In this analysis, there were substantial differences between older BM and WM living with HIV. After controlling for sociodemographic and clinical challenges, BM still reported higher QoL than WM. Programs designed to improve QoL for older gay and bisexual BM and WM living with HIV should take into consideration the unique strengths and challenges faced by each group. DISCLOSURES: Peter Mazonson, MD, MBA, ViiV Healthcare (Grant/Research Support) Theoren Loo, MS, BS, ViiV Healthcare (Grant/Research Support) Jeff Berko, MPH, BS, ViiV Healthcare (Grant/Research Support) Oluwatoyin Adeyemi, MD, ViiV Healthcare (Grant/Research Support) Alan Oglesby, MPH, ViiV Healthcare (Employee) Frank Spinelli, MD, ViiV Healthcare (Employee) Andrew Zolopa, MD, ViiV Healthcare (Employee)
format Online
Article
Text
id pubmed-7777159
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Oxford University Press
record_format MEDLINE/PubMed
spelling pubmed-77771592021-01-07 943. Older Gay Black Men Living with HIV Report Higher Quality of Life than Older Gay White Men, Despite Facing Additional Burdens Mazonson, Peter Loo, Theoren Berko, Jeff Adeyemi, Oluwatoyin Oglesby, Alan Spinelli, Frank Zolopa, Andrew Open Forum Infect Dis Poster Abstracts BACKGROUND: Improving quality of life (QoL) is an important goal of care for people living with HIV (PLWH). This analysis uses data from the Aging with Dignity, Health, Optimism and Community (ADHOC) online registry to identify the different challenges faced by older white/Caucasian (“white”) and black/African American (“black”) gay or bisexual men living with HIV, and to assess differences in total QoL between the two groups. METHODS: QoL was measured using the PozQoL, a validated instrument for PLWH. The PozQoL assesses QoL across four domains: health concerns, psychological, social, and functional wellbeing. Total QoL was determined by combining domain scores for a total score. Student’s t-tests and chi-squared tests were used to identify disparities between black and white men. Factors with p< 0.05 were used as control variables in a multivariable linear regression model where PozQoL total score was the dependent variable. RESULTS: In the ADHOC database, 91% (n=612) of respondents were white men (WM) and 9% (n=59) were black men (BM). Both BM and WM had a median age of 59 years, and had a similar number of comorbidities (7.9 vs 9.2 respectively, p=0.12). Compared to WM, BM were more likely to be single (74% vs 51%, p< 0.001), less likely to have an income greater than $50,000 (25% vs 56%, p< 0.001), less likely to have a college degree or more (42% vs 69%, p=0.034), and less likely to be virally suppressed (87% vs 96%, p=0.001). Even after controlling for these differences in the multivariable model, BM had significantly higher total QoL than WM (Table 1). CONCLUSION: In this analysis, there were substantial differences between older BM and WM living with HIV. After controlling for sociodemographic and clinical challenges, BM still reported higher QoL than WM. Programs designed to improve QoL for older gay and bisexual BM and WM living with HIV should take into consideration the unique strengths and challenges faced by each group. DISCLOSURES: Peter Mazonson, MD, MBA, ViiV Healthcare (Grant/Research Support) Theoren Loo, MS, BS, ViiV Healthcare (Grant/Research Support) Jeff Berko, MPH, BS, ViiV Healthcare (Grant/Research Support) Oluwatoyin Adeyemi, MD, ViiV Healthcare (Grant/Research Support) Alan Oglesby, MPH, ViiV Healthcare (Employee) Frank Spinelli, MD, ViiV Healthcare (Employee) Andrew Zolopa, MD, ViiV Healthcare (Employee) Oxford University Press 2020-12-31 /pmc/articles/PMC7777159/ http://dx.doi.org/10.1093/ofid/ofaa439.1129 Text en © The Author 2020. Published by Oxford University Press on behalf of Infectious Diseases Society of America. http://creativecommons.org/licenses/by-nc-nd/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution-NonCommercial-NoDerivs licence (http://creativecommons.org/licenses/by-nc-nd/4.0/), which permits non-commercial reproduction and distribution of the work, in any medium, provided the original work is not altered or transformed in any way, and that the work is properly cited. For commercial re-use, please contact journals.permissions@oup.com
spellingShingle Poster Abstracts
Mazonson, Peter
Loo, Theoren
Berko, Jeff
Adeyemi, Oluwatoyin
Oglesby, Alan
Spinelli, Frank
Zolopa, Andrew
943. Older Gay Black Men Living with HIV Report Higher Quality of Life than Older Gay White Men, Despite Facing Additional Burdens
title 943. Older Gay Black Men Living with HIV Report Higher Quality of Life than Older Gay White Men, Despite Facing Additional Burdens
title_full 943. Older Gay Black Men Living with HIV Report Higher Quality of Life than Older Gay White Men, Despite Facing Additional Burdens
title_fullStr 943. Older Gay Black Men Living with HIV Report Higher Quality of Life than Older Gay White Men, Despite Facing Additional Burdens
title_full_unstemmed 943. Older Gay Black Men Living with HIV Report Higher Quality of Life than Older Gay White Men, Despite Facing Additional Burdens
title_short 943. Older Gay Black Men Living with HIV Report Higher Quality of Life than Older Gay White Men, Despite Facing Additional Burdens
title_sort 943. older gay black men living with hiv report higher quality of life than older gay white men, despite facing additional burdens
topic Poster Abstracts
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7777159/
http://dx.doi.org/10.1093/ofid/ofaa439.1129
work_keys_str_mv AT mazonsonpeter 943oldergayblackmenlivingwithhivreporthigherqualityoflifethanoldergaywhitemendespitefacingadditionalburdens
AT lootheoren 943oldergayblackmenlivingwithhivreporthigherqualityoflifethanoldergaywhitemendespitefacingadditionalburdens
AT berkojeff 943oldergayblackmenlivingwithhivreporthigherqualityoflifethanoldergaywhitemendespitefacingadditionalburdens
AT adeyemioluwatoyin 943oldergayblackmenlivingwithhivreporthigherqualityoflifethanoldergaywhitemendespitefacingadditionalburdens
AT oglesbyalan 943oldergayblackmenlivingwithhivreporthigherqualityoflifethanoldergaywhitemendespitefacingadditionalburdens
AT spinellifrank 943oldergayblackmenlivingwithhivreporthigherqualityoflifethanoldergaywhitemendespitefacingadditionalburdens
AT zolopaandrew 943oldergayblackmenlivingwithhivreporthigherqualityoflifethanoldergaywhitemendespitefacingadditionalburdens