Cargando…

The complete chloroplast genome of Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang (Family: Vitaceae) and its phylogenetic analysis

Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang is rich in flavonoids and also displays excellent pharmacological activities. The phylogenetic relationship between A. grossedentata and other related Vitaceae family members remains unclear. The chloroplast (cp) genome is a useful model for assessin...

Descripción completa

Detalles Bibliográficos
Autores principales: Gu, Lei, Zhang, Ni, Feng, Chun, Yi, Yin, Yu, Zheng-Wen
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7782978/
https://www.ncbi.nlm.nih.gov/pubmed/33457812
http://dx.doi.org/10.1080/23802359.2020.1775508
_version_ 1783632020993212416
author Gu, Lei
Zhang, Ni
Feng, Chun
Yi, Yin
Yu, Zheng-Wen
author_facet Gu, Lei
Zhang, Ni
Feng, Chun
Yi, Yin
Yu, Zheng-Wen
author_sort Gu, Lei
collection PubMed
description Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang is rich in flavonoids and also displays excellent pharmacological activities. The phylogenetic relationship between A. grossedentata and other related Vitaceae family members remains unclear. The chloroplast (cp) genome is a useful model for assessing genome evolution. In this study, we assembled the cp genome of A. grossedentata using the high-throughput Illumina pair-end sequencing data and characterized the genome to providing useful information for future genetic studies. The circular cp genome was 162,147 bp in size, including a large single-copy (LSC) region of 89,244 bp and a small single-copy (SSC) region of 18,439 bp, which were separated by two inverted repeat (IR) regions (27,232 bp each). A total of 135 genes were predicted, including 8 ribosomal RNAs (rRNAs), 37 transfer RNAs (tRNAs), and 90 protein-coding genes (PCGs). Furthermore, phylogenetic analysis revealed that A. grossedentata within Ampelopsis genus and formed a different clade from other three congeneric species. This study provides useful information for future genetic study of A. grossedentata.
format Online
Article
Text
id pubmed-7782978
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-77829782021-01-14 The complete chloroplast genome of Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang (Family: Vitaceae) and its phylogenetic analysis Gu, Lei Zhang, Ni Feng, Chun Yi, Yin Yu, Zheng-Wen Mitochondrial DNA B Resour Mitogenome Announcement Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang is rich in flavonoids and also displays excellent pharmacological activities. The phylogenetic relationship between A. grossedentata and other related Vitaceae family members remains unclear. The chloroplast (cp) genome is a useful model for assessing genome evolution. In this study, we assembled the cp genome of A. grossedentata using the high-throughput Illumina pair-end sequencing data and characterized the genome to providing useful information for future genetic studies. The circular cp genome was 162,147 bp in size, including a large single-copy (LSC) region of 89,244 bp and a small single-copy (SSC) region of 18,439 bp, which were separated by two inverted repeat (IR) regions (27,232 bp each). A total of 135 genes were predicted, including 8 ribosomal RNAs (rRNAs), 37 transfer RNAs (tRNAs), and 90 protein-coding genes (PCGs). Furthermore, phylogenetic analysis revealed that A. grossedentata within Ampelopsis genus and formed a different clade from other three congeneric species. This study provides useful information for future genetic study of A. grossedentata. Taylor & Francis 2020-06-11 /pmc/articles/PMC7782978/ /pubmed/33457812 http://dx.doi.org/10.1080/23802359.2020.1775508 Text en © 2020 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Mitogenome Announcement
Gu, Lei
Zhang, Ni
Feng, Chun
Yi, Yin
Yu, Zheng-Wen
The complete chloroplast genome of Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang (Family: Vitaceae) and its phylogenetic analysis
title The complete chloroplast genome of Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang (Family: Vitaceae) and its phylogenetic analysis
title_full The complete chloroplast genome of Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang (Family: Vitaceae) and its phylogenetic analysis
title_fullStr The complete chloroplast genome of Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang (Family: Vitaceae) and its phylogenetic analysis
title_full_unstemmed The complete chloroplast genome of Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang (Family: Vitaceae) and its phylogenetic analysis
title_short The complete chloroplast genome of Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang (Family: Vitaceae) and its phylogenetic analysis
title_sort complete chloroplast genome of ampelopsis grossedentata (hand.-mazz.) w. t. wang (family: vitaceae) and its phylogenetic analysis
topic Mitogenome Announcement
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7782978/
https://www.ncbi.nlm.nih.gov/pubmed/33457812
http://dx.doi.org/10.1080/23802359.2020.1775508
work_keys_str_mv AT gulei thecompletechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis
AT zhangni thecompletechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis
AT fengchun thecompletechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis
AT yiyin thecompletechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis
AT yuzhengwen thecompletechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis
AT gulei completechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis
AT zhangni completechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis
AT fengchun completechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis
AT yiyin completechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis
AT yuzhengwen completechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis