Cargando…
The complete chloroplast genome of Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang (Family: Vitaceae) and its phylogenetic analysis
Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang is rich in flavonoids and also displays excellent pharmacological activities. The phylogenetic relationship between A. grossedentata and other related Vitaceae family members remains unclear. The chloroplast (cp) genome is a useful model for assessin...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Taylor & Francis
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7782978/ https://www.ncbi.nlm.nih.gov/pubmed/33457812 http://dx.doi.org/10.1080/23802359.2020.1775508 |
_version_ | 1783632020993212416 |
---|---|
author | Gu, Lei Zhang, Ni Feng, Chun Yi, Yin Yu, Zheng-Wen |
author_facet | Gu, Lei Zhang, Ni Feng, Chun Yi, Yin Yu, Zheng-Wen |
author_sort | Gu, Lei |
collection | PubMed |
description | Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang is rich in flavonoids and also displays excellent pharmacological activities. The phylogenetic relationship between A. grossedentata and other related Vitaceae family members remains unclear. The chloroplast (cp) genome is a useful model for assessing genome evolution. In this study, we assembled the cp genome of A. grossedentata using the high-throughput Illumina pair-end sequencing data and characterized the genome to providing useful information for future genetic studies. The circular cp genome was 162,147 bp in size, including a large single-copy (LSC) region of 89,244 bp and a small single-copy (SSC) region of 18,439 bp, which were separated by two inverted repeat (IR) regions (27,232 bp each). A total of 135 genes were predicted, including 8 ribosomal RNAs (rRNAs), 37 transfer RNAs (tRNAs), and 90 protein-coding genes (PCGs). Furthermore, phylogenetic analysis revealed that A. grossedentata within Ampelopsis genus and formed a different clade from other three congeneric species. This study provides useful information for future genetic study of A. grossedentata. |
format | Online Article Text |
id | pubmed-7782978 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Taylor & Francis |
record_format | MEDLINE/PubMed |
spelling | pubmed-77829782021-01-14 The complete chloroplast genome of Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang (Family: Vitaceae) and its phylogenetic analysis Gu, Lei Zhang, Ni Feng, Chun Yi, Yin Yu, Zheng-Wen Mitochondrial DNA B Resour Mitogenome Announcement Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang is rich in flavonoids and also displays excellent pharmacological activities. The phylogenetic relationship between A. grossedentata and other related Vitaceae family members remains unclear. The chloroplast (cp) genome is a useful model for assessing genome evolution. In this study, we assembled the cp genome of A. grossedentata using the high-throughput Illumina pair-end sequencing data and characterized the genome to providing useful information for future genetic studies. The circular cp genome was 162,147 bp in size, including a large single-copy (LSC) region of 89,244 bp and a small single-copy (SSC) region of 18,439 bp, which were separated by two inverted repeat (IR) regions (27,232 bp each). A total of 135 genes were predicted, including 8 ribosomal RNAs (rRNAs), 37 transfer RNAs (tRNAs), and 90 protein-coding genes (PCGs). Furthermore, phylogenetic analysis revealed that A. grossedentata within Ampelopsis genus and formed a different clade from other three congeneric species. This study provides useful information for future genetic study of A. grossedentata. Taylor & Francis 2020-06-11 /pmc/articles/PMC7782978/ /pubmed/33457812 http://dx.doi.org/10.1080/23802359.2020.1775508 Text en © 2020 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Mitogenome Announcement Gu, Lei Zhang, Ni Feng, Chun Yi, Yin Yu, Zheng-Wen The complete chloroplast genome of Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang (Family: Vitaceae) and its phylogenetic analysis |
title | The complete chloroplast genome of Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang (Family: Vitaceae) and its phylogenetic analysis |
title_full | The complete chloroplast genome of Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang (Family: Vitaceae) and its phylogenetic analysis |
title_fullStr | The complete chloroplast genome of Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang (Family: Vitaceae) and its phylogenetic analysis |
title_full_unstemmed | The complete chloroplast genome of Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang (Family: Vitaceae) and its phylogenetic analysis |
title_short | The complete chloroplast genome of Ampelopsis grossedentata (Hand.-Mazz.) W. T. Wang (Family: Vitaceae) and its phylogenetic analysis |
title_sort | complete chloroplast genome of ampelopsis grossedentata (hand.-mazz.) w. t. wang (family: vitaceae) and its phylogenetic analysis |
topic | Mitogenome Announcement |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7782978/ https://www.ncbi.nlm.nih.gov/pubmed/33457812 http://dx.doi.org/10.1080/23802359.2020.1775508 |
work_keys_str_mv | AT gulei thecompletechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis AT zhangni thecompletechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis AT fengchun thecompletechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis AT yiyin thecompletechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis AT yuzhengwen thecompletechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis AT gulei completechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis AT zhangni completechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis AT fengchun completechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis AT yiyin completechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis AT yuzhengwen completechloroplastgenomeofampelopsisgrossedentatahandmazzwtwangfamilyvitaceaeanditsphylogeneticanalysis |