Cargando…
Integrated analyses of miRNA and mRNA profiles in leukocytes and serums in traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome and Pi-wei damp-heat syndrome resulting from chronic atrophic gastritis
BACKGROUND: To investigate the microRNA (miRNA)-gene interactions underlying leukocyte functions and characteristics, especially the potential serum biomarkers, implicated in the traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome (PQDS) and Pi-wei damp-heat syndrome (PDHS) resultin...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7788792/ https://www.ncbi.nlm.nih.gov/pubmed/33407671 http://dx.doi.org/10.1186/s13020-020-00416-9 |
_version_ | 1783633100299829248 |
---|---|
author | You, Leiming Zhang, Shen Li, Ting’an Sang, Xiaopu Li, Kunyu Wang, Wei Gao, Xinhui Wu, Jiarui Huang, Guangrui Wang, Ting Xu, Anlong |
author_facet | You, Leiming Zhang, Shen Li, Ting’an Sang, Xiaopu Li, Kunyu Wang, Wei Gao, Xinhui Wu, Jiarui Huang, Guangrui Wang, Ting Xu, Anlong |
author_sort | You, Leiming |
collection | PubMed |
description | BACKGROUND: To investigate the microRNA (miRNA)-gene interactions underlying leukocyte functions and characteristics, especially the potential serum biomarkers, implicated in the traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome (PQDS) and Pi-wei damp-heat syndrome (PDHS) resulting from chronic atrophic gastritis (CAG). METHODS: Using RNA/miRNA-sequencing approach, compared with healthy control population, we identified the PDHS- or PQDS-specific miRNAs and genes in leukocytes or serums, especially the Zheng (syndrome)-specific miRNA-gene interactions, and further decoded their functions and pathways. RESULTS: Despite being the TCM-defined Zhengs resulting from the same disease of CAG, the Zheng-specific genes and miRNAs were not same. The PDHS-specific leukocyte genes were mainly involved in defense and immune responses, including NOD-like receptor signaling and several synapses-related pathways. The expression upregulation of PDHS-specific genes enriched in the neutrophil degranulation pathway, indicated the enhanced leukocyte degranulation activation. The PQDS-specific genes in leukocytes were implicated in inflammatory response, extracellular matrix (ECM) organization and collagen catabolism. They could be enriched in MAPK and IL17 signaling and helper T cell differentiation pathways, especially the pathways associated with cell-to-cell adhesion/junction and communication such as cell adhesion molecules, ECM organization and ECM-receptor interaction, probably contributing to the characteristics and functions of leukocytes. Also, the experimentally-supported miRNA-gene interactions, concerned with COL4A2, COL26A1, SPP1 and PROCR, were implicated in the regulation of pathways related to cell-to-cell adhesion/junction and communication, suggesting the potential roles of the PQDS-specific miRNA-gene interactions for the characteristic and functional changes of leukocytes. Interestingly, the PQDS-specific miRNAs in the serums and the corresponding leukocytes, seemed to have the common roles in contributing to the characteristics and functions of leukocytes. Importantly, the hsa-miR-122-5p could be a potential biomarker, capable of being contained and carried in plasma exosomes and much higher expression in both the leukocytes and corresponding serums in the CAG patients with PQDS rather than PDHS. CONCLUSIONS: These results may provide new insights into the characteristic and functional changes of leukocytes in the two Zhengs, PDHS and PQDS, especially the miRNA-mediated gene regulation underlying leukocyte characteristics and functions, with potential leukocyte and serum biomarkers for future application in integrative medicine. Trial registration ClinicalTrials.gov, NCT02915393. Registered on September 17, 2016. |
format | Online Article Text |
id | pubmed-7788792 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-77887922021-01-07 Integrated analyses of miRNA and mRNA profiles in leukocytes and serums in traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome and Pi-wei damp-heat syndrome resulting from chronic atrophic gastritis You, Leiming Zhang, Shen Li, Ting’an Sang, Xiaopu Li, Kunyu Wang, Wei Gao, Xinhui Wu, Jiarui Huang, Guangrui Wang, Ting Xu, Anlong Chin Med Research BACKGROUND: To investigate the microRNA (miRNA)-gene interactions underlying leukocyte functions and characteristics, especially the potential serum biomarkers, implicated in the traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome (PQDS) and Pi-wei damp-heat syndrome (PDHS) resulting from chronic atrophic gastritis (CAG). METHODS: Using RNA/miRNA-sequencing approach, compared with healthy control population, we identified the PDHS- or PQDS-specific miRNAs and genes in leukocytes or serums, especially the Zheng (syndrome)-specific miRNA-gene interactions, and further decoded their functions and pathways. RESULTS: Despite being the TCM-defined Zhengs resulting from the same disease of CAG, the Zheng-specific genes and miRNAs were not same. The PDHS-specific leukocyte genes were mainly involved in defense and immune responses, including NOD-like receptor signaling and several synapses-related pathways. The expression upregulation of PDHS-specific genes enriched in the neutrophil degranulation pathway, indicated the enhanced leukocyte degranulation activation. The PQDS-specific genes in leukocytes were implicated in inflammatory response, extracellular matrix (ECM) organization and collagen catabolism. They could be enriched in MAPK and IL17 signaling and helper T cell differentiation pathways, especially the pathways associated with cell-to-cell adhesion/junction and communication such as cell adhesion molecules, ECM organization and ECM-receptor interaction, probably contributing to the characteristics and functions of leukocytes. Also, the experimentally-supported miRNA-gene interactions, concerned with COL4A2, COL26A1, SPP1 and PROCR, were implicated in the regulation of pathways related to cell-to-cell adhesion/junction and communication, suggesting the potential roles of the PQDS-specific miRNA-gene interactions for the characteristic and functional changes of leukocytes. Interestingly, the PQDS-specific miRNAs in the serums and the corresponding leukocytes, seemed to have the common roles in contributing to the characteristics and functions of leukocytes. Importantly, the hsa-miR-122-5p could be a potential biomarker, capable of being contained and carried in plasma exosomes and much higher expression in both the leukocytes and corresponding serums in the CAG patients with PQDS rather than PDHS. CONCLUSIONS: These results may provide new insights into the characteristic and functional changes of leukocytes in the two Zhengs, PDHS and PQDS, especially the miRNA-mediated gene regulation underlying leukocyte characteristics and functions, with potential leukocyte and serum biomarkers for future application in integrative medicine. Trial registration ClinicalTrials.gov, NCT02915393. Registered on September 17, 2016. BioMed Central 2021-01-06 /pmc/articles/PMC7788792/ /pubmed/33407671 http://dx.doi.org/10.1186/s13020-020-00416-9 Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research You, Leiming Zhang, Shen Li, Ting’an Sang, Xiaopu Li, Kunyu Wang, Wei Gao, Xinhui Wu, Jiarui Huang, Guangrui Wang, Ting Xu, Anlong Integrated analyses of miRNA and mRNA profiles in leukocytes and serums in traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome and Pi-wei damp-heat syndrome resulting from chronic atrophic gastritis |
title | Integrated analyses of miRNA and mRNA profiles in leukocytes and serums in traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome and Pi-wei damp-heat syndrome resulting from chronic atrophic gastritis |
title_full | Integrated analyses of miRNA and mRNA profiles in leukocytes and serums in traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome and Pi-wei damp-heat syndrome resulting from chronic atrophic gastritis |
title_fullStr | Integrated analyses of miRNA and mRNA profiles in leukocytes and serums in traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome and Pi-wei damp-heat syndrome resulting from chronic atrophic gastritis |
title_full_unstemmed | Integrated analyses of miRNA and mRNA profiles in leukocytes and serums in traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome and Pi-wei damp-heat syndrome resulting from chronic atrophic gastritis |
title_short | Integrated analyses of miRNA and mRNA profiles in leukocytes and serums in traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome and Pi-wei damp-heat syndrome resulting from chronic atrophic gastritis |
title_sort | integrated analyses of mirna and mrna profiles in leukocytes and serums in traditional chinese medicine (tcm)-defined pi-qi-deficiency syndrome and pi-wei damp-heat syndrome resulting from chronic atrophic gastritis |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7788792/ https://www.ncbi.nlm.nih.gov/pubmed/33407671 http://dx.doi.org/10.1186/s13020-020-00416-9 |
work_keys_str_mv | AT youleiming integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis AT zhangshen integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis AT litingan integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis AT sangxiaopu integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis AT likunyu integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis AT wangwei integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis AT gaoxinhui integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis AT wujiarui integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis AT huangguangrui integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis AT wangting integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis AT xuanlong integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis |