Cargando…

Integrated analyses of miRNA and mRNA profiles in leukocytes and serums in traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome and Pi-wei damp-heat syndrome resulting from chronic atrophic gastritis

BACKGROUND: To investigate the microRNA (miRNA)-gene interactions underlying leukocyte functions and characteristics, especially the potential serum biomarkers, implicated in the traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome (PQDS) and Pi-wei damp-heat syndrome (PDHS) resultin...

Descripción completa

Detalles Bibliográficos
Autores principales: You, Leiming, Zhang, Shen, Li, Ting’an, Sang, Xiaopu, Li, Kunyu, Wang, Wei, Gao, Xinhui, Wu, Jiarui, Huang, Guangrui, Wang, Ting, Xu, Anlong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7788792/
https://www.ncbi.nlm.nih.gov/pubmed/33407671
http://dx.doi.org/10.1186/s13020-020-00416-9
_version_ 1783633100299829248
author You, Leiming
Zhang, Shen
Li, Ting’an
Sang, Xiaopu
Li, Kunyu
Wang, Wei
Gao, Xinhui
Wu, Jiarui
Huang, Guangrui
Wang, Ting
Xu, Anlong
author_facet You, Leiming
Zhang, Shen
Li, Ting’an
Sang, Xiaopu
Li, Kunyu
Wang, Wei
Gao, Xinhui
Wu, Jiarui
Huang, Guangrui
Wang, Ting
Xu, Anlong
author_sort You, Leiming
collection PubMed
description BACKGROUND: To investigate the microRNA (miRNA)-gene interactions underlying leukocyte functions and characteristics, especially the potential serum biomarkers, implicated in the traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome (PQDS) and Pi-wei damp-heat syndrome (PDHS) resulting from chronic atrophic gastritis (CAG). METHODS: Using RNA/miRNA-sequencing approach, compared with healthy control population, we identified the PDHS- or PQDS-specific miRNAs and genes in leukocytes or serums, especially the Zheng (syndrome)-specific miRNA-gene interactions, and further decoded their functions and pathways. RESULTS: Despite being the TCM-defined Zhengs resulting from the same disease of CAG, the Zheng-specific genes and miRNAs were not same. The PDHS-specific leukocyte genes were mainly involved in defense and immune responses, including NOD-like receptor signaling and several synapses-related pathways. The expression upregulation of PDHS-specific genes enriched in the neutrophil degranulation pathway, indicated the enhanced leukocyte degranulation activation. The PQDS-specific genes in leukocytes were implicated in inflammatory response, extracellular matrix (ECM) organization and collagen catabolism. They could be enriched in MAPK and IL17 signaling and helper T cell differentiation pathways, especially the pathways associated with cell-to-cell adhesion/junction and communication such as cell adhesion molecules, ECM organization and ECM-receptor interaction, probably contributing to the characteristics and functions of leukocytes. Also, the experimentally-supported miRNA-gene interactions, concerned with COL4A2, COL26A1, SPP1 and PROCR, were implicated in the regulation of pathways related to cell-to-cell adhesion/junction and communication, suggesting the potential roles of the PQDS-specific miRNA-gene interactions for the characteristic and functional changes of leukocytes. Interestingly, the PQDS-specific miRNAs in the serums and the corresponding leukocytes, seemed to have the common roles in contributing to the characteristics and functions of leukocytes. Importantly, the hsa-miR-122-5p could be a potential biomarker, capable of being contained and carried in plasma exosomes and much higher expression in both the leukocytes and corresponding serums in the CAG patients with PQDS rather than PDHS. CONCLUSIONS: These results may provide new insights into the characteristic and functional changes of leukocytes in the two Zhengs, PDHS and PQDS, especially the miRNA-mediated gene regulation underlying leukocyte characteristics and functions, with potential leukocyte and serum biomarkers for future application in integrative medicine. Trial registration ClinicalTrials.gov, NCT02915393. Registered on September 17, 2016.
format Online
Article
Text
id pubmed-7788792
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-77887922021-01-07 Integrated analyses of miRNA and mRNA profiles in leukocytes and serums in traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome and Pi-wei damp-heat syndrome resulting from chronic atrophic gastritis You, Leiming Zhang, Shen Li, Ting’an Sang, Xiaopu Li, Kunyu Wang, Wei Gao, Xinhui Wu, Jiarui Huang, Guangrui Wang, Ting Xu, Anlong Chin Med Research BACKGROUND: To investigate the microRNA (miRNA)-gene interactions underlying leukocyte functions and characteristics, especially the potential serum biomarkers, implicated in the traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome (PQDS) and Pi-wei damp-heat syndrome (PDHS) resulting from chronic atrophic gastritis (CAG). METHODS: Using RNA/miRNA-sequencing approach, compared with healthy control population, we identified the PDHS- or PQDS-specific miRNAs and genes in leukocytes or serums, especially the Zheng (syndrome)-specific miRNA-gene interactions, and further decoded their functions and pathways. RESULTS: Despite being the TCM-defined Zhengs resulting from the same disease of CAG, the Zheng-specific genes and miRNAs were not same. The PDHS-specific leukocyte genes were mainly involved in defense and immune responses, including NOD-like receptor signaling and several synapses-related pathways. The expression upregulation of PDHS-specific genes enriched in the neutrophil degranulation pathway, indicated the enhanced leukocyte degranulation activation. The PQDS-specific genes in leukocytes were implicated in inflammatory response, extracellular matrix (ECM) organization and collagen catabolism. They could be enriched in MAPK and IL17 signaling and helper T cell differentiation pathways, especially the pathways associated with cell-to-cell adhesion/junction and communication such as cell adhesion molecules, ECM organization and ECM-receptor interaction, probably contributing to the characteristics and functions of leukocytes. Also, the experimentally-supported miRNA-gene interactions, concerned with COL4A2, COL26A1, SPP1 and PROCR, were implicated in the regulation of pathways related to cell-to-cell adhesion/junction and communication, suggesting the potential roles of the PQDS-specific miRNA-gene interactions for the characteristic and functional changes of leukocytes. Interestingly, the PQDS-specific miRNAs in the serums and the corresponding leukocytes, seemed to have the common roles in contributing to the characteristics and functions of leukocytes. Importantly, the hsa-miR-122-5p could be a potential biomarker, capable of being contained and carried in plasma exosomes and much higher expression in both the leukocytes and corresponding serums in the CAG patients with PQDS rather than PDHS. CONCLUSIONS: These results may provide new insights into the characteristic and functional changes of leukocytes in the two Zhengs, PDHS and PQDS, especially the miRNA-mediated gene regulation underlying leukocyte characteristics and functions, with potential leukocyte and serum biomarkers for future application in integrative medicine. Trial registration ClinicalTrials.gov, NCT02915393. Registered on September 17, 2016. BioMed Central 2021-01-06 /pmc/articles/PMC7788792/ /pubmed/33407671 http://dx.doi.org/10.1186/s13020-020-00416-9 Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
You, Leiming
Zhang, Shen
Li, Ting’an
Sang, Xiaopu
Li, Kunyu
Wang, Wei
Gao, Xinhui
Wu, Jiarui
Huang, Guangrui
Wang, Ting
Xu, Anlong
Integrated analyses of miRNA and mRNA profiles in leukocytes and serums in traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome and Pi-wei damp-heat syndrome resulting from chronic atrophic gastritis
title Integrated analyses of miRNA and mRNA profiles in leukocytes and serums in traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome and Pi-wei damp-heat syndrome resulting from chronic atrophic gastritis
title_full Integrated analyses of miRNA and mRNA profiles in leukocytes and serums in traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome and Pi-wei damp-heat syndrome resulting from chronic atrophic gastritis
title_fullStr Integrated analyses of miRNA and mRNA profiles in leukocytes and serums in traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome and Pi-wei damp-heat syndrome resulting from chronic atrophic gastritis
title_full_unstemmed Integrated analyses of miRNA and mRNA profiles in leukocytes and serums in traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome and Pi-wei damp-heat syndrome resulting from chronic atrophic gastritis
title_short Integrated analyses of miRNA and mRNA profiles in leukocytes and serums in traditional Chinese medicine (TCM)-defined Pi-qi-deficiency syndrome and Pi-wei damp-heat syndrome resulting from chronic atrophic gastritis
title_sort integrated analyses of mirna and mrna profiles in leukocytes and serums in traditional chinese medicine (tcm)-defined pi-qi-deficiency syndrome and pi-wei damp-heat syndrome resulting from chronic atrophic gastritis
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7788792/
https://www.ncbi.nlm.nih.gov/pubmed/33407671
http://dx.doi.org/10.1186/s13020-020-00416-9
work_keys_str_mv AT youleiming integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis
AT zhangshen integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis
AT litingan integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis
AT sangxiaopu integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis
AT likunyu integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis
AT wangwei integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis
AT gaoxinhui integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis
AT wujiarui integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis
AT huangguangrui integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis
AT wangting integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis
AT xuanlong integratedanalysesofmirnaandmrnaprofilesinleukocytesandserumsintraditionalchinesemedicinetcmdefinedpiqideficiencysyndromeandpiweidampheatsyndromeresultingfromchronicatrophicgastritis