Cargando…

Reshaping healthcare delivery for elderly patients: the role of community paramedicine; a systematic review

BACKGROUND: Healthcare systems are overloaded and changing. In response to growing demands on the healthcare systems, new models of healthcare delivery are emerging. Community paramedicine is a novel approach in which paramedics use their knowledge and skills beyond emergency health response to cont...

Descripción completa

Detalles Bibliográficos
Autores principales: van Vuuren, Julia, Thomas, Brodie, Agarwal, Gina, MacDermott, Sean, Kinsman, Leigh, O’Meara, Peter, Spelten, Evelien
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7789625/
https://www.ncbi.nlm.nih.gov/pubmed/33407406
http://dx.doi.org/10.1186/s12913-020-06037-0
_version_ 1783633281084817408
author van Vuuren, Julia
Thomas, Brodie
Agarwal, Gina
MacDermott, Sean
Kinsman, Leigh
O’Meara, Peter
Spelten, Evelien
author_facet van Vuuren, Julia
Thomas, Brodie
Agarwal, Gina
MacDermott, Sean
Kinsman, Leigh
O’Meara, Peter
Spelten, Evelien
author_sort van Vuuren, Julia
collection PubMed
description BACKGROUND: Healthcare systems are overloaded and changing. In response to growing demands on the healthcare systems, new models of healthcare delivery are emerging. Community paramedicine is a novel approach in which paramedics use their knowledge and skills beyond emergency health response to contribute to preventative and rehabilitative health. In our systematic review, we aimed to identify evidence of the community paramedicine role in care delivery for elderly patients, with an additional focus on palliative care, and the possible impact of this role on the wider healthcare system. METHODS: A systematic review of peer-reviewed literature from MEDLINE, Embase, CINAHL, and Web of Sciences was undertaken to identify relevant full-text articles in English published until October 3, 2019. Additional inclusion criteria were studies focussing on extended care paramedics or community paramedics caring for elderly patients. Case studies were excluded. All papers were screened by at least two authors and underwent a quality assessment, using the Joanna Briggs Institute appraisal checklists for cross sectional, qualitative, cohort, and randomised controlled trial studies to assess the methodological quality of the articles. A process of narrative synthesis was used to summarise the data. RESULTS: Ten studies, across 13 articles, provided clear evidence that Community Paramedic programs had a positive impact on the health of patients and on the wider healthcare system. The role of a Community Paramedic was often a combination of four aspects: assessment, referral, education and communication. Limited evidence was available on the involvement of Community Paramedics in palliative and end-of-life care and in care delivery in residential aged care facilities. Observed challenges were a lack of additional training, and the need for proper integration and understanding of their role in the healthcare system. CONCLUSIONS: The use of community paramedics in care delivery could be beneficial to both patients’ health and the wider healthcare system. They already play a promising role in improving the care of our elderly population. With consistent adherence to the training curriculum and effective integration within the wider healthcare system, community paramedics have the potential to take on specialised roles in residential aged care facilities and palliative and end-of-life care. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12913-020-06037-0.
format Online
Article
Text
id pubmed-7789625
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-77896252021-01-07 Reshaping healthcare delivery for elderly patients: the role of community paramedicine; a systematic review van Vuuren, Julia Thomas, Brodie Agarwal, Gina MacDermott, Sean Kinsman, Leigh O’Meara, Peter Spelten, Evelien BMC Health Serv Res Research Article BACKGROUND: Healthcare systems are overloaded and changing. In response to growing demands on the healthcare systems, new models of healthcare delivery are emerging. Community paramedicine is a novel approach in which paramedics use their knowledge and skills beyond emergency health response to contribute to preventative and rehabilitative health. In our systematic review, we aimed to identify evidence of the community paramedicine role in care delivery for elderly patients, with an additional focus on palliative care, and the possible impact of this role on the wider healthcare system. METHODS: A systematic review of peer-reviewed literature from MEDLINE, Embase, CINAHL, and Web of Sciences was undertaken to identify relevant full-text articles in English published until October 3, 2019. Additional inclusion criteria were studies focussing on extended care paramedics or community paramedics caring for elderly patients. Case studies were excluded. All papers were screened by at least two authors and underwent a quality assessment, using the Joanna Briggs Institute appraisal checklists for cross sectional, qualitative, cohort, and randomised controlled trial studies to assess the methodological quality of the articles. A process of narrative synthesis was used to summarise the data. RESULTS: Ten studies, across 13 articles, provided clear evidence that Community Paramedic programs had a positive impact on the health of patients and on the wider healthcare system. The role of a Community Paramedic was often a combination of four aspects: assessment, referral, education and communication. Limited evidence was available on the involvement of Community Paramedics in palliative and end-of-life care and in care delivery in residential aged care facilities. Observed challenges were a lack of additional training, and the need for proper integration and understanding of their role in the healthcare system. CONCLUSIONS: The use of community paramedics in care delivery could be beneficial to both patients’ health and the wider healthcare system. They already play a promising role in improving the care of our elderly population. With consistent adherence to the training curriculum and effective integration within the wider healthcare system, community paramedics have the potential to take on specialised roles in residential aged care facilities and palliative and end-of-life care. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12913-020-06037-0. BioMed Central 2021-01-06 /pmc/articles/PMC7789625/ /pubmed/33407406 http://dx.doi.org/10.1186/s12913-020-06037-0 Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
van Vuuren, Julia
Thomas, Brodie
Agarwal, Gina
MacDermott, Sean
Kinsman, Leigh
O’Meara, Peter
Spelten, Evelien
Reshaping healthcare delivery for elderly patients: the role of community paramedicine; a systematic review
title Reshaping healthcare delivery for elderly patients: the role of community paramedicine; a systematic review
title_full Reshaping healthcare delivery for elderly patients: the role of community paramedicine; a systematic review
title_fullStr Reshaping healthcare delivery for elderly patients: the role of community paramedicine; a systematic review
title_full_unstemmed Reshaping healthcare delivery for elderly patients: the role of community paramedicine; a systematic review
title_short Reshaping healthcare delivery for elderly patients: the role of community paramedicine; a systematic review
title_sort reshaping healthcare delivery for elderly patients: the role of community paramedicine; a systematic review
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7789625/
https://www.ncbi.nlm.nih.gov/pubmed/33407406
http://dx.doi.org/10.1186/s12913-020-06037-0
work_keys_str_mv AT vanvuurenjulia reshapinghealthcaredeliveryforelderlypatientstheroleofcommunityparamedicineasystematicreview
AT thomasbrodie reshapinghealthcaredeliveryforelderlypatientstheroleofcommunityparamedicineasystematicreview
AT agarwalgina reshapinghealthcaredeliveryforelderlypatientstheroleofcommunityparamedicineasystematicreview
AT macdermottsean reshapinghealthcaredeliveryforelderlypatientstheroleofcommunityparamedicineasystematicreview
AT kinsmanleigh reshapinghealthcaredeliveryforelderlypatientstheroleofcommunityparamedicineasystematicreview
AT omearapeter reshapinghealthcaredeliveryforelderlypatientstheroleofcommunityparamedicineasystematicreview
AT speltenevelien reshapinghealthcaredeliveryforelderlypatientstheroleofcommunityparamedicineasystematicreview