Cargando…
Transcriptomic analysis identifies organ-specific metastasis genes and pathways across different primary sites
BACKGROUND: Metastasis is the most devastating stage of cancer progression and often shows a preference for specific organs. METHODS: To reveal the mechanisms underlying organ-specific metastasis, we systematically analyzed gene expression profiles for three common metastasis sites across all availa...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7791985/ https://www.ncbi.nlm.nih.gov/pubmed/33413400 http://dx.doi.org/10.1186/s12967-020-02696-z |
_version_ | 1783633709328498688 |
---|---|
author | Zhang, Lin Fan, Ming Napolitano, Francesco Gao, Xin Xu, Ying Li, Lihua |
author_facet | Zhang, Lin Fan, Ming Napolitano, Francesco Gao, Xin Xu, Ying Li, Lihua |
author_sort | Zhang, Lin |
collection | PubMed |
description | BACKGROUND: Metastasis is the most devastating stage of cancer progression and often shows a preference for specific organs. METHODS: To reveal the mechanisms underlying organ-specific metastasis, we systematically analyzed gene expression profiles for three common metastasis sites across all available primary origins. A rank-based method was used to detect differentially expressed genes between metastatic tumor tissues and corresponding control tissues. For each metastasis site, the common differentially expressed genes across all primary origins were identified as organ-specific metastasis genes. RESULTS: Pathways enriched by these genes reveal an interplay between the molecular characteristics of the cancer cells and those of the target organ. Specifically, the neuroactive ligand-receptor interaction pathway and HIF-1 signaling pathway were found to have prominent roles in adapting to the target organ environment in brain and liver metastases, respectively. Finally, the identified organ-specific metastasis genes and pathways were validated using a primary breast tumor dataset. Survival and cluster analysis showed that organ-specific metastasis genes and pathways tended to be expressed uniquely by a subgroup of patients having metastasis to the target organ, and were associated with the clinical outcome. CONCLUSIONS: Elucidating the genes and pathways underlying organ-specific metastasis may help to identify drug targets and develop treatment strategies to benefit patients. |
format | Online Article Text |
id | pubmed-7791985 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-77919852021-01-11 Transcriptomic analysis identifies organ-specific metastasis genes and pathways across different primary sites Zhang, Lin Fan, Ming Napolitano, Francesco Gao, Xin Xu, Ying Li, Lihua J Transl Med Research BACKGROUND: Metastasis is the most devastating stage of cancer progression and often shows a preference for specific organs. METHODS: To reveal the mechanisms underlying organ-specific metastasis, we systematically analyzed gene expression profiles for three common metastasis sites across all available primary origins. A rank-based method was used to detect differentially expressed genes between metastatic tumor tissues and corresponding control tissues. For each metastasis site, the common differentially expressed genes across all primary origins were identified as organ-specific metastasis genes. RESULTS: Pathways enriched by these genes reveal an interplay between the molecular characteristics of the cancer cells and those of the target organ. Specifically, the neuroactive ligand-receptor interaction pathway and HIF-1 signaling pathway were found to have prominent roles in adapting to the target organ environment in brain and liver metastases, respectively. Finally, the identified organ-specific metastasis genes and pathways were validated using a primary breast tumor dataset. Survival and cluster analysis showed that organ-specific metastasis genes and pathways tended to be expressed uniquely by a subgroup of patients having metastasis to the target organ, and were associated with the clinical outcome. CONCLUSIONS: Elucidating the genes and pathways underlying organ-specific metastasis may help to identify drug targets and develop treatment strategies to benefit patients. BioMed Central 2021-01-07 /pmc/articles/PMC7791985/ /pubmed/33413400 http://dx.doi.org/10.1186/s12967-020-02696-z Text en © The Author(s) 2021 Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Zhang, Lin Fan, Ming Napolitano, Francesco Gao, Xin Xu, Ying Li, Lihua Transcriptomic analysis identifies organ-specific metastasis genes and pathways across different primary sites |
title | Transcriptomic analysis identifies organ-specific metastasis genes and pathways across different primary sites |
title_full | Transcriptomic analysis identifies organ-specific metastasis genes and pathways across different primary sites |
title_fullStr | Transcriptomic analysis identifies organ-specific metastasis genes and pathways across different primary sites |
title_full_unstemmed | Transcriptomic analysis identifies organ-specific metastasis genes and pathways across different primary sites |
title_short | Transcriptomic analysis identifies organ-specific metastasis genes and pathways across different primary sites |
title_sort | transcriptomic analysis identifies organ-specific metastasis genes and pathways across different primary sites |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7791985/ https://www.ncbi.nlm.nih.gov/pubmed/33413400 http://dx.doi.org/10.1186/s12967-020-02696-z |
work_keys_str_mv | AT zhanglin transcriptomicanalysisidentifiesorganspecificmetastasisgenesandpathwaysacrossdifferentprimarysites AT fanming transcriptomicanalysisidentifiesorganspecificmetastasisgenesandpathwaysacrossdifferentprimarysites AT napolitanofrancesco transcriptomicanalysisidentifiesorganspecificmetastasisgenesandpathwaysacrossdifferentprimarysites AT gaoxin transcriptomicanalysisidentifiesorganspecificmetastasisgenesandpathwaysacrossdifferentprimarysites AT xuying transcriptomicanalysisidentifiesorganspecificmetastasisgenesandpathwaysacrossdifferentprimarysites AT lilihua transcriptomicanalysisidentifiesorganspecificmetastasisgenesandpathwaysacrossdifferentprimarysites |