The complete mitochondrial genome of the cave shrimp Typhlatya miravetensis (Decapoda, Atyidae) and its systematic position

The complete mitochondrial genome of Typhlatya miravetensis from one of its only three known localities (Ullal de la Rabla de Miravet, Castellón, Spain) is presented here. The mitogenome is 15,865 bp in length and includes the standard set of two rRNAs, two non-coding regions plus 13 protein-coding...

Descripción completa

Detalles Bibliográficos
Autores principales: Jurado-Rivera, José A., Jaume, Damià, Juan, Carlos, Pons, Joan
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2016
Materias:
Mitogenome Announcement
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7799957/
https://www.ncbi.nlm.nih.gov/pubmed/33473652
http://dx.doi.org/10.1080/23802359.2016.1238756
_version_ 1783635242152624128
author Jurado-Rivera, José A.
Jaume, Damià
Juan, Carlos
Pons, Joan
author_facet Jurado-Rivera, José A.
Jaume, Damià
Juan, Carlos
Pons, Joan
author_sort Jurado-Rivera, José A.
collection PubMed
description The complete mitochondrial genome of Typhlatya miravetensis from one of its only three known localities (Ullal de la Rabla de Miravet, Castellón, Spain) is presented here. The mitogenome is 15,865 bp in length and includes the standard set of two rRNAs, two non-coding regions plus 13 protein-coding genes. The later have been used to perform a phylogenetic analysis together with other Caridea representatives with mitogenome data in GenBank, inferring a close relationship with the Hawaiian volcano shirmp (Halocaridina rubra) within the family Atyidae.
format Online
Article
Text
id pubmed-7799957
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-77999572021-01-19 The complete mitochondrial genome of the cave shrimp Typhlatya miravetensis (Decapoda, Atyidae) and its systematic position Jurado-Rivera, José A. Jaume, Damià Juan, Carlos Pons, Joan Mitochondrial DNA B Resour Mitogenome Announcement The complete mitochondrial genome of Typhlatya miravetensis from one of its only three known localities (Ullal de la Rabla de Miravet, Castellón, Spain) is presented here. The mitogenome is 15,865 bp in length and includes the standard set of two rRNAs, two non-coding regions plus 13 protein-coding genes. The later have been used to perform a phylogenetic analysis together with other Caridea representatives with mitogenome data in GenBank, inferring a close relationship with the Hawaiian volcano shirmp (Halocaridina rubra) within the family Atyidae. Taylor & Francis 2016-11-12 /pmc/articles/PMC7799957/ /pubmed/33473652 http://dx.doi.org/10.1080/23802359.2016.1238756 Text en © 2016 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. http://creativecommons.org/licenses/by/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.http://creativecommons.org/licenses/by/4.0/
spellingShingle Mitogenome Announcement
Jurado-Rivera, José A.
Jaume, Damià
Juan, Carlos
Pons, Joan
The complete mitochondrial genome of the cave shrimp Typhlatya miravetensis (Decapoda, Atyidae) and its systematic position
title The complete mitochondrial genome of the cave shrimp Typhlatya miravetensis (Decapoda, Atyidae) and its systematic position
title_full The complete mitochondrial genome of the cave shrimp Typhlatya miravetensis (Decapoda, Atyidae) and its systematic position
title_fullStr The complete mitochondrial genome of the cave shrimp Typhlatya miravetensis (Decapoda, Atyidae) and its systematic position
title_full_unstemmed The complete mitochondrial genome of the cave shrimp Typhlatya miravetensis (Decapoda, Atyidae) and its systematic position
title_short The complete mitochondrial genome of the cave shrimp Typhlatya miravetensis (Decapoda, Atyidae) and its systematic position
title_sort complete mitochondrial genome of the cave shrimp typhlatya miravetensis (decapoda, atyidae) and its systematic position
topic Mitogenome Announcement
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7799957/
https://www.ncbi.nlm.nih.gov/pubmed/33473652
http://dx.doi.org/10.1080/23802359.2016.1238756
work_keys_str_mv AT juradoriverajosea thecompletemitochondrialgenomeofthecaveshrimptyphlatyamiravetensisdecapodaatyidaeanditssystematicposition
AT jaumedamia thecompletemitochondrialgenomeofthecaveshrimptyphlatyamiravetensisdecapodaatyidaeanditssystematicposition
AT juancarlos thecompletemitochondrialgenomeofthecaveshrimptyphlatyamiravetensisdecapodaatyidaeanditssystematicposition
AT ponsjoan thecompletemitochondrialgenomeofthecaveshrimptyphlatyamiravetensisdecapodaatyidaeanditssystematicposition
AT juradoriverajosea completemitochondrialgenomeofthecaveshrimptyphlatyamiravetensisdecapodaatyidaeanditssystematicposition
AT jaumedamia completemitochondrialgenomeofthecaveshrimptyphlatyamiravetensisdecapodaatyidaeanditssystematicposition
AT juancarlos completemitochondrialgenomeofthecaveshrimptyphlatyamiravetensisdecapodaatyidaeanditssystematicposition
AT ponsjoan completemitochondrialgenomeofthecaveshrimptyphlatyamiravetensisdecapodaatyidaeanditssystematicposition

Ejemplares similares