Cargando…

Characterization of the complete plastid genome of a Chinese endemic species Carya kweichowensis

Carya kweichowensis is an importantly economic tree species in Juglandaceae, which is critically endangered and endemic to Guizhou, China. The plastid genome of C. kweichowensis was assembled and characterized based on Illumina pair-end sequencing data using genome skimming approach. The complete pl...

Descripción completa

Detalles Bibliográficos
Autores principales: Ye, Linjiang, Fu, Chaonan, Wang, Yuehua, Liu, Jie, Gao, Lianming
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7799995/
https://www.ncbi.nlm.nih.gov/pubmed/33474216
http://dx.doi.org/10.1080/23802359.2018.1464414
_version_ 1783635251060277248
author Ye, Linjiang
Fu, Chaonan
Wang, Yuehua
Liu, Jie
Gao, Lianming
author_facet Ye, Linjiang
Fu, Chaonan
Wang, Yuehua
Liu, Jie
Gao, Lianming
author_sort Ye, Linjiang
collection PubMed
description Carya kweichowensis is an importantly economic tree species in Juglandaceae, which is critically endangered and endemic to Guizhou, China. The plastid genome of C. kweichowensis was assembled and characterized based on Illumina pair-end sequencing data using genome skimming approach. The complete plastid genome is 175,313 bp in length, with a GC content of 35.8%. It is a typical quadripartite structure, containing a large single copy (LSC) region of 89,858 bp and a small single copy (SSC) region of 3569 bp separated by a pair of extremely extensive inverted repeats (IRs) of 40,943 bp. A total of 142 genes were annotated, including 94 protein-coding genes, 40 tRNA genes, and eight rRNA genes. A maximum likelihood (ML) phylogenetic tree on plastid genomes revealed that C. kweichowensis is close to Annamocarya sinensis. The newly characterized complete plastid genome of C. kweichowensis will provide essential data for further studies of this endangered species.
format Online
Article
Text
id pubmed-7799995
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-77999952021-01-19 Characterization of the complete plastid genome of a Chinese endemic species Carya kweichowensis Ye, Linjiang Fu, Chaonan Wang, Yuehua Liu, Jie Gao, Lianming Mitochondrial DNA B Resour Mitogenome Announcement Carya kweichowensis is an importantly economic tree species in Juglandaceae, which is critically endangered and endemic to Guizhou, China. The plastid genome of C. kweichowensis was assembled and characterized based on Illumina pair-end sequencing data using genome skimming approach. The complete plastid genome is 175,313 bp in length, with a GC content of 35.8%. It is a typical quadripartite structure, containing a large single copy (LSC) region of 89,858 bp and a small single copy (SSC) region of 3569 bp separated by a pair of extremely extensive inverted repeats (IRs) of 40,943 bp. A total of 142 genes were annotated, including 94 protein-coding genes, 40 tRNA genes, and eight rRNA genes. A maximum likelihood (ML) phylogenetic tree on plastid genomes revealed that C. kweichowensis is close to Annamocarya sinensis. The newly characterized complete plastid genome of C. kweichowensis will provide essential data for further studies of this endangered species. Taylor & Francis 2018-04-23 /pmc/articles/PMC7799995/ /pubmed/33474216 http://dx.doi.org/10.1080/23802359.2018.1464414 Text en © 2018 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. http://creativecommons.org/licenses/by/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.http://creativecommons.org/licenses/by/4.0/
spellingShingle Mitogenome Announcement
Ye, Linjiang
Fu, Chaonan
Wang, Yuehua
Liu, Jie
Gao, Lianming
Characterization of the complete plastid genome of a Chinese endemic species Carya kweichowensis
title Characterization of the complete plastid genome of a Chinese endemic species Carya kweichowensis
title_full Characterization of the complete plastid genome of a Chinese endemic species Carya kweichowensis
title_fullStr Characterization of the complete plastid genome of a Chinese endemic species Carya kweichowensis
title_full_unstemmed Characterization of the complete plastid genome of a Chinese endemic species Carya kweichowensis
title_short Characterization of the complete plastid genome of a Chinese endemic species Carya kweichowensis
title_sort characterization of the complete plastid genome of a chinese endemic species carya kweichowensis
topic Mitogenome Announcement
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7799995/
https://www.ncbi.nlm.nih.gov/pubmed/33474216
http://dx.doi.org/10.1080/23802359.2018.1464414
work_keys_str_mv AT yelinjiang characterizationofthecompleteplastidgenomeofachineseendemicspeciescaryakweichowensis
AT fuchaonan characterizationofthecompleteplastidgenomeofachineseendemicspeciescaryakweichowensis
AT wangyuehua characterizationofthecompleteplastidgenomeofachineseendemicspeciescaryakweichowensis
AT liujie characterizationofthecompleteplastidgenomeofachineseendemicspeciescaryakweichowensis
AT gaolianming characterizationofthecompleteplastidgenomeofachineseendemicspeciescaryakweichowensis