Cargando…
Characterization of the complete plastid genome of a Chinese endemic species Carya kweichowensis
Carya kweichowensis is an importantly economic tree species in Juglandaceae, which is critically endangered and endemic to Guizhou, China. The plastid genome of C. kweichowensis was assembled and characterized based on Illumina pair-end sequencing data using genome skimming approach. The complete pl...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Taylor & Francis
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7799995/ https://www.ncbi.nlm.nih.gov/pubmed/33474216 http://dx.doi.org/10.1080/23802359.2018.1464414 |
_version_ | 1783635251060277248 |
---|---|
author | Ye, Linjiang Fu, Chaonan Wang, Yuehua Liu, Jie Gao, Lianming |
author_facet | Ye, Linjiang Fu, Chaonan Wang, Yuehua Liu, Jie Gao, Lianming |
author_sort | Ye, Linjiang |
collection | PubMed |
description | Carya kweichowensis is an importantly economic tree species in Juglandaceae, which is critically endangered and endemic to Guizhou, China. The plastid genome of C. kweichowensis was assembled and characterized based on Illumina pair-end sequencing data using genome skimming approach. The complete plastid genome is 175,313 bp in length, with a GC content of 35.8%. It is a typical quadripartite structure, containing a large single copy (LSC) region of 89,858 bp and a small single copy (SSC) region of 3569 bp separated by a pair of extremely extensive inverted repeats (IRs) of 40,943 bp. A total of 142 genes were annotated, including 94 protein-coding genes, 40 tRNA genes, and eight rRNA genes. A maximum likelihood (ML) phylogenetic tree on plastid genomes revealed that C. kweichowensis is close to Annamocarya sinensis. The newly characterized complete plastid genome of C. kweichowensis will provide essential data for further studies of this endangered species. |
format | Online Article Text |
id | pubmed-7799995 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Taylor & Francis |
record_format | MEDLINE/PubMed |
spelling | pubmed-77999952021-01-19 Characterization of the complete plastid genome of a Chinese endemic species Carya kweichowensis Ye, Linjiang Fu, Chaonan Wang, Yuehua Liu, Jie Gao, Lianming Mitochondrial DNA B Resour Mitogenome Announcement Carya kweichowensis is an importantly economic tree species in Juglandaceae, which is critically endangered and endemic to Guizhou, China. The plastid genome of C. kweichowensis was assembled and characterized based on Illumina pair-end sequencing data using genome skimming approach. The complete plastid genome is 175,313 bp in length, with a GC content of 35.8%. It is a typical quadripartite structure, containing a large single copy (LSC) region of 89,858 bp and a small single copy (SSC) region of 3569 bp separated by a pair of extremely extensive inverted repeats (IRs) of 40,943 bp. A total of 142 genes were annotated, including 94 protein-coding genes, 40 tRNA genes, and eight rRNA genes. A maximum likelihood (ML) phylogenetic tree on plastid genomes revealed that C. kweichowensis is close to Annamocarya sinensis. The newly characterized complete plastid genome of C. kweichowensis will provide essential data for further studies of this endangered species. Taylor & Francis 2018-04-23 /pmc/articles/PMC7799995/ /pubmed/33474216 http://dx.doi.org/10.1080/23802359.2018.1464414 Text en © 2018 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. http://creativecommons.org/licenses/by/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.http://creativecommons.org/licenses/by/4.0/ |
spellingShingle | Mitogenome Announcement Ye, Linjiang Fu, Chaonan Wang, Yuehua Liu, Jie Gao, Lianming Characterization of the complete plastid genome of a Chinese endemic species Carya kweichowensis |
title | Characterization of the complete plastid genome of a Chinese endemic species Carya kweichowensis |
title_full | Characterization of the complete plastid genome of a Chinese endemic species Carya kweichowensis |
title_fullStr | Characterization of the complete plastid genome of a Chinese endemic species Carya kweichowensis |
title_full_unstemmed | Characterization of the complete plastid genome of a Chinese endemic species Carya kweichowensis |
title_short | Characterization of the complete plastid genome of a Chinese endemic species Carya kweichowensis |
title_sort | characterization of the complete plastid genome of a chinese endemic species carya kweichowensis |
topic | Mitogenome Announcement |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7799995/ https://www.ncbi.nlm.nih.gov/pubmed/33474216 http://dx.doi.org/10.1080/23802359.2018.1464414 |
work_keys_str_mv | AT yelinjiang characterizationofthecompleteplastidgenomeofachineseendemicspeciescaryakweichowensis AT fuchaonan characterizationofthecompleteplastidgenomeofachineseendemicspeciescaryakweichowensis AT wangyuehua characterizationofthecompleteplastidgenomeofachineseendemicspeciescaryakweichowensis AT liujie characterizationofthecompleteplastidgenomeofachineseendemicspeciescaryakweichowensis AT gaolianming characterizationofthecompleteplastidgenomeofachineseendemicspeciescaryakweichowensis |